KEGG   Aspergillus fischeri: NFIA_048850Help
Entry
NFIA_048850       CDS       T01070                                 

Definition
(RefSeq) alpha-galactosidase/alpha-n-acetylgalactosaminidase
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00052  Galactose metabolism
nfi00561  Glycerolipid metabolism
nfi00600  Sphingolipid metabolism
nfi00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NFIA_048850
  Lipid metabolism
   00561 Glycerolipid metabolism
    NFIA_048850
   00600 Sphingolipid metabolism
    NFIA_048850
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    NFIA_048850
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     NFIA_048850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase
Motif
Other DBs
NCBI-GeneID: 4583959
NCBI-ProteinID: XP_001257445
UniProt: A1DL77
AA seq 481 aa AA seqDB search
MGLSSLLLSAALFGLKASALNNGLARTPQMGWNTWNSFACELNETVILNAAERIVSLGFR
DLGYEYVVLDDCWSAGRNSSGYLIADSEKFPNGIAHLADKVHELGLKIGIYSSAGTWTCA
RYEGSLGYEEKDAALWASWGIDYLKYDNCYNEGEEGTPKLSFDRYNAMFKALNATGRPML
YSLCNWGVDGPWNFAPTIANSWRTAGDLSNVWDRDDVNCPCSELEGLDCKTPGYKCSIMN
VLNKAVYYPSKAIPGAWNDLDMLQVGNGGLTDDESIAHMSLWAALKSPLLMTNVMTKIDP
PTLSILQNPAVLAVSQDPVASTPVRQWRYFVDDVDENGKGEIQMYSGPLSGGDQLVLLLN
AGSKAREMNATLVDIFWESGPKGTAKQVKQHWDVYDLWANRMSNEDAAAIINGTFTGPSP
YNLTAMGGAHEVYSRPLPSNSKVLMGSKVGSVQPSGTVTAHVRPHGIAMLRLRATDKKDE
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggggctctcttcgctgctgctctccgcggcgctcttcggcctcaaggcctctgcattg
aacaatggcttagctcggacaccgcagatgggatggaacacctggaattcgttcgcctgt
gaactcaacgagacagtcattctcaatgcggcggagagaattgtttctcttggtttcaga
gacttgggatacgaatatgtggtcttggacgactgctggtcggccggccggaactcgtct
ggctacctcatcgccgactccgagaagttcccgaatggaatcgcccatctcgcagacaaa
gtccatgagttgggcctgaaaatcggcatctactccagcgctggaacatggacttgcgcg
cggtatgagggctcgctcggttacgaggaaaaggacgctgccctctgggcaagctggggt
atcgactacctcaaatacgacaactgctacaacgaaggcgaagaaggtaccccgaagcta
tcctttgaccgctacaacgccatgttcaaggccctcaatgcaaccggccgcccaatgctc
tattccctgtgcaactggggcgtcgacgggccctggaacttcgccccaaccatcgccaac
tcctggcgcacggctggcgatctgagcaacgtctgggaccgcgacgacgtcaattgcccc
tgttccgaactggagggcctggactgcaagacgccgggttacaaatgctccatcatgaac
gtcctcaacaaggccgtctactacccgtccaaggcgatcccaggcgcctggaacgacctc
gacatgctccaggtcggcaacggcggcctcaccgacgacgaatcaatcgcccacatgagc
ctctgggccgccctcaaatcccccctcctcatgacaaacgtcatgaccaagatcgacccg
cccaccctctccatcctccagaacccggccgtcctcgccgtctcgcaggaccccgttgcc
tccacccccgtccgccagtggcgctacttcgtcgacgacgtcgatgagaacggcaagggc
gagatccagatgtactctggtccgctgagcggcggcgaccagctggtgctgctgctgaac
gcggggtccaaggctcgcgagatgaacgccacgctggtcgatatcttctgggagagtggg
cccaagggaacggcgaaacaggtcaagcagcactgggatgtgtatgatctgtgggccaac
cggatgagcaatgaggatgcggcggccatcattaatgggacgtttactgggccgtcgccc
tataacttgactgctatgggtggggcgcatgaggtctattcgcgccctctgccgtcgaat
tcgaaggtgttgatggggtccaaggttgggtcggtgcagcctagtggcacggttacggct
catgttcggccgcatggtatcgctatgttgcggttgcgcgcgaccgacaagaaggatgaa
ttgtga

DBGET integrated database retrieval system