KEGG   Aspergillus fischeri: NFIA_049200Help
Entry
NFIA_049200       CDS       T01070                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00630  Glyoxylate and dicarboxylate metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01200  Carbon metabolism
Module
nfi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NFIA_049200
Enzymes [BR:nfi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     NFIA_049200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 4583993
NCBI-ProteinID: XP_001257479
UniProt: A1DLB1
AA seq 565 aa AA seqDB search
MSSSPLPTVEPPVSTTLPSDSFQLLSTAEKAGTAEDALYEQQIKDVEAWWKSPRFEGIKR
PYSAADVVSKRGTLQQTYPSSLMARKLFNLLNERAAEGKPVHTMGAIDPVQMTQQAPNQE
VLYISGWACSSLLTTTNEVSPDFGDYPYNTVPNQVQRLFKAQQMHDRKQWDARRKMTPEQ
RKSTPYVDYMRPIVADGDTGHGGLSAVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGK
VLVPIGEHINRLVAARFQWDMMGVENLVIARTDSESGKLISSAIDVRDHEFILGVAEEVE
PLAETLQAMEREGAAPAEVDAFELEWVKKHKLVTFDEAVDAHLEAEGAPQSARDAYKKRV
QENPDLSISRRRALASDYTKKPVVWSCDSPRTREGFYHYRAGFPAATKRAKEFAPYADLL
WVETGDPNVENAGKLASDVRAAYPGKKLVYNLSPSFNWMGQGFDEASLKSFVWDLAKHGF
VLQLISLAGLHSNATITTELSRAFKDEGMLAYVRLIQSREKELGVEVLTHQKWSGAPYMD
GILGAIQSGSSSSKSMGEGNTEKGF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcatctccgctgccgaccgttgagccccccgtttcgacgaccttgccatcagac
tcatttcagttgctgtcaacagctgagaaggccgggactgcggaggatgcactttatgag
caacaaatcaaagatgtagaggcatggtggaaatctccgcggttcgagggtatcaagaga
ccctactcggccgcggacgttgtcagcaaacgtggcactttgcagcagacatatccgagt
tctttaatggctcgtaagctgttcaatctgctgaatgagagagcggcagagggaaagccg
gttcataccatgggcgcaatcgatcccgtacaaatgacacagcaagctccaaaccaggag
gtgctgtatatctcaggatgggcgtgctcctccctcttgactacaacgaatgaggtttct
ccggactttggcgactacccgtacaataccgtccccaatcaggtacagagattgttcaag
gcgcaacagatgcatgatcgcaaacaatgggatgctaggcgaaaaatgaccccggaacag
cgaaagtcgaccccttatgttgactacatgagaccgatcgttgcagatggcgataccgga
catggcggtctttccgcggtcctcaaattggccaagcttttcgcggagaacggtgctgca
gctgttcacttcgaagatcagctgcatggcggcaagaagtgcggtcatctggcagggaaa
gtccttgtgcctattggagaacacatcaaccgactggtcgccgctcgtttccaatgggac
atgatgggagtcgagaatctggtgatcgctcgaacagattccgagagtgggaagttgatt
agcagcgccatcgatgtgcgtgatcacgagttcatcctcggtgttgcggaggaggtcgag
cctttggctgagaccctacaagcaatggagcgcgaaggtgctgctcctgcagaggtcgac
gcatttgagctggagtgggtcaagaagcacaagcttgtcacttttgatgaagctgtcgac
gcacatctcgaagccgaaggagcgccccagtctgcccgtgatgcatacaagaagagggtt
caagagaaccctgacctgtctatctcgcgtcgccgagctctggcgagcgactacacaaag
aaacccgttgtctggtcttgcgacagtcccaggaccagggagggattctaccactaccgt
gccggctttccggcagcgacaaagcgagccaaggaatttgccccttatgcggacctcttg
tgggttgaaactggcgaccccaatgtcgagaatgctggaaaactagcaagcgatgttcgc
gccgcataccccgggaagaaactggtctataaccttagcccgtcattcaactggatgggt
cagggctttgacgaggcgtctctcaagtcttttgtctgggatctcgccaagcacggcttt
gtcctccaactcatctcccttgccggtctgcacagcaatgccacaatcacgaccgaactt
tcacgcgccttcaaggacgagggaatgctcgcttacgtgcgactgatccagtcccgcgag
aaggaactcggggtcgaggtcctcacccaccagaaatggagcggtgcaccatacatggac
ggcatcctgggcgccatccagagcggcagtagcagcagcaagagcatgggagagggaaac
actgagaagggcttctaa

DBGET integrated database retrieval system