KEGG   Aspergillus fischeri: NFIA_049580Help
Entry
NFIA_049580       CDS       T01070                                 

Definition
(RefSeq) tryptophan synthase beta chain
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
nfi  Aspergillus fischeri
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NFIA_049580
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NFIA_049580
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NFIA_049580
Enzymes [BR:nfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NFIA_049580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 689 aa AA seqDB search
MDYLKQVFAQCHREGRPALVTYVTAGFPTAKETPDIMLGMQAGGADILELGLPFTDPIAD
GPTIQKSNLKALENGVTITSMLEMVRTARRKGLKAPVLFMGYYNPILQYGESKLLADCVD
AGVNGFIIVDLPPEEAVRFRNGCMKTGLSYVPLIAPSTTEDRMKVLCNMADSFIYLVSRM
GVTGATGTLNADLPALIRRVKELSGNIPVAVGFGISTREHFLSVTSIADGAVIGSQVITI
LDNAPAGQAARVVEDYCSQITQRKVTSAPGAAMETNVVIQPVVDGEAAVTDGSGRFGVFG
GQYAPEALTTCLAELEAGFEAARNDPAFWEEYESYYPYMGRPSSLHLAPRLSEHAGGANI
WLKREDLNHTGSHKINNALGQILIARRLGKTEIIAETGAGQHGVATATVCAKFGMKCTVY
MGAEDVRRQALNVFRIRLLGATVVPVESGSRTLRDAVNEAFRAWIARLETTHYIIGSAIG
PHPFPTMVRTFQSVIGEETKVQLRGLGKSPDAVVACVGGGSNAVGMFYPFSQDGSVQLVG
VEAAGDGLDTERHSATLGRGSIGVLHGVRTYVLQNQHGQISDTHSVSAGLDYPGVGPELA
HWNESNRATFLSATDAQAMQGFRLLSQLEGIIPALETSHAVWGAVKVAKQLGPGRDLVLC
LSGRGDKDVQTVIDELPKIGPQIGWDLRF
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggattatctaaaacaggtctttgcccagtgccaccgggaaggccgtccagcgctggtc
acgtacgtgacggccggattccccacggcgaaggaaaccccggacatcatgctgggcatg
caggccggaggagcagatattcttgaactgggtctcccctttaccgatcctatcgcagac
ggtccgaccatccaaaagtcgaatttgaaggctctcgaaaatggggtcacaatcacctcg
atgttggagatggttaggactgcgcggagaaaagggttaaaggctccggtgctgtttatg
gggtactataatcctatactgcagtatggagagtcgaagcttttggcagattgcgtcgac
gccggggtcaatggtttcattattgttgatctgcccccggaagaagcggttcgatttcga
aatggctgcatgaagacgggactctcatacgtccctttgatcgcaccttccaccaccgaa
gaccgcatgaaggtcctctgcaacatggccgattcttttatctatcttgtctcccgcatg
ggtgtcaccggcgccactgggaccctcaacgcagaccttcccgccctcatccggcgcgtc
aaggagctctctggcaatatccccgtggccgttgggtttggaatcagcactcgcgagcat
ttcctgagcgtgacctccatcgccgacggtgccgtcatcggcagccaggtgattacgatc
ctcgataacgcccctgccggacaggccgcccgggtggtcgaggactattgctcgcagatt
acacaaagaaaggttaccagtgcacctggtgcggcaatggagacgaacgtggtcatccag
cctgttgtcgatggagaggcggctgtgactgacggatcagggcggttcggtgtcttcggc
ggccaatacgccccagaggcactgaccacctgcctggccgaacttgaagccggtttcgag
gccgctaggaatgatccggccttctgggaggagtatgaatcgtactatccgtacatgggt
cgtccctccagcctacacctggctccgcgactgtccgaacacgccggcggcgcgaatatc
tggctgaagcgggaggacctcaaccacacgggatcccacaagatcaacaacgcgctgggc
cagatcctgattgcgcgtcggttgggtaagacggagatcatcgccgagaccggcgcaggc
cagcacggggtcgcaactgccactgtctgtgcgaaattcggcatgaagtgcaccgtctac
atgggtgctgaggatgtccgtcgccaggcgttgaacgtgttccggattcgcttgttgggg
gctacggttgtcccagttgaatcggggtcgcgcacgctccgagatgcggtgaatgaagcc
tttcgtgcgtggattgcgcgcctggagaccacgcattatattatcggatccgcgatcgga
ccccatccctttccgaccatggttcgcacgttccagagcgtgataggcgaggagaccaag
gttcagctgcgaggcctgggcaagtccccggatgcagtggtcgcctgtgttgggggcggc
tctaacgctgtcggcatgttctatccattctcacaggacggctccgtccagctggttggg
gtggaagccgcaggtgatggcttggacacagaacggcattcggctaccttgggtcgaggc
tcgatcggggttcttcatggcgttcggacctatgtcctgcagaaccagcatggacagatc
tccgacactcactcagtctctgcgggactggattaccccggtgttgggccggaactagcg
cactggaacgagagcaaccgggcgacatttctttcggctactgatgcccaggccatgcag
ggattccgcctgctgagccagctggaaggcatcattcccgctttggagacctcccacgcg
gtctggggggcagtcaaggtagccaagcagctgggaccgggaagggatcttgtgttatgc
ttgagtggccgtggtgacaaagacgtgcagaccgtgatcgatgagttgcccaagatagga
ccccagattggatgggacttgcgattttaa

DBGET integrated database retrieval system