KEGG   Neosartorya fischeri: NFIA_050050Help
Entry
NFIA_050050       CDS       T01070                                 

Definition
malate synthase AcuE
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nfi  Neosartorya fischeri
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NFIA_050050
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NFIA_050050
   00630 Glyoxylate and dicarboxylate metabolism
    NFIA_050050
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     NFIA_050050
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MSQMEVQLKDVAILGAVNNEHRKILTKEACAFLAILHRTFNPTRKALLQRRIDRQAEIDK
GHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWSNMINGQVNLYDAIRRQVDFKQGNKEYKLRTDRTLPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELVARGHGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRATVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDAYVKLLIKTCHRRGVHAMGGMAAQIPIKDNAAANDKAMENVRADKLREV
RAGHDGTWVAHPALAAIASEVFNKYMPTPNQLFVRREDVNITANDLLNTNVPGKITEDGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVHHQVTSSEGKKIDKAY
ALRLLQEQADSLAAKSPKGNKFQLAARYFAGQVTGEDYADFLTSLLYNEISTPGTASKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatggaagtacagctcaaggatgtcgccatcctgggcgccgtgaacaacgag
catcgcaagattctcaccaaggaagcttgcgctttcctcgccatcctccaccgcaccttc
aaccctacccggaaagccctcctgcagcgccgtatcgatcgccaggccgagatcgacaag
ggtcatctgcctgacttcctccccgagactaagcacattcgtgaaaatgacgcctggaag
ggtgctcctcccgctcccggtctggttgaccgtcgcgtggagatcactggtcccacagac
cgcaagatggtcgtcaatgctctgaatgcggacgtctggacttatatggcggatttcgag
gactcgagtgcccctacctggtcgaacatgatcaacggccaagtcaacttgtacgatgct
atccgccgtcaggtcgacttcaagcaaggaaacaaggagtacaagctccgcacagaccgc
acccttcccaccctgattgctcgtgctcgaggctggcaccttgacgagaagcactttact
gttgacggcgagcctatctccggcagcttgttcgactttggtctttacttcttccacaac
gccaaggagctggttgctcgcggccacggtccttacttctacctccccaagatggagtcc
cacctcgaggccagactctggaatgacgtcttcaacctcgctcaggactacattggcatg
ccccggggaaccatccgtgctactgttctgattgagaccatcactgctgcgtttgagatg
gatgagattatctatgaactgcgtgaccacagctccggtctcaactgcggccgctgggat
tacatcttctccttcattaagaagttccgcaagcaccccaactttgtccttcccgaccgc
tccgacgtcaccatgaccgtgccattcatggacgcctatgtgaagctgctcatcaagact
tgccaccgccgtggtgttcacgctatgggtggtatggctgctcagatccctatcaaggac
aacgccgccgccaacgacaaggccatggagaacgtgcgcgccgacaagctgcgtgaggtc
cgtgccggccacgacggtacctgggttgctcaccccgctctcgccgccatagcctccgag
gtcttcaacaagtacatgcctacccccaaccagctgttcgtccgccgggaggacgtcaac
atcaccgccaacgatctgctcaacaccaatgtccctggcaagatcaccgaagatggtatc
cgcaagaatttgaacatcggtctttcctacatggagggctggctccgcggtgtcggctgc
atcccgatcaactacctgatggaggacgccgctaccgccgaagtttcccggtctcagctc
tggcagtgggtgcaccaccaggtcaccagctctgagggcaagaagatcgacaaggcctac
gctctgcgtctgctccaggagcaggccgacagcctggccgccaagtcacccaagggcaac
aagttccagctggcggcccgttactttgccggtcaggtgacgggtgaggactatgcggac
ttccttaccagtctgctgtacaatgagatctcgaccccgggtactgcgtcgaaattgtag

DBGET integrated database retrieval system