KEGG   Neosartorya fischeri: NFIA_050050Help
Entry
NFIA_050050       CDS       T01070                                 

Definition
malate synthase AcuE
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nfi  Neosartorya fischeri
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:nfi01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:nfi00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:nfi00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 539 aa AA seqDB search
MSQMEVQLKDVAILGAVNNEHRKILTKEACAFLAILHRTFNPTRKALLQRRIDRQAEIDK
GHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWSNMINGQVNLYDAIRRQVDFKQGNKEYKLRTDRTLPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELVARGHGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRATVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDAYVKLLIKTCHRRGVHAMGGMAAQIPIKDNAAANDKAMENVRADKLREV
RAGHDGTWVAHPALAAIASEVFNKYMPTPNQLFVRREDVNITANDLLNTNVPGKITEDGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVHHQVTSSEGKKIDKAY
ALRLLQEQADSLAAKSPKGNKFQLAARYFAGQVTGEDYADFLTSLLYNEISTPGTASKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatggaagtacagctcaaggatgtcgccatcctgggcgccgtgaacaacgag
catcgcaagattctcaccaaggaagcttgcgctttcctcgccatcctccaccgcaccttc
aaccctacccggaaagccctcctgcagcgccgtatcgatcgccaggccgagatcgacaag
ggtcatctgcctgacttcctccccgagactaagcacattcgtgaaaatgacgcctggaag
ggtgctcctcccgctcccggtctggttgaccgtcgcgtggagatcactggtcccacagac
cgcaagatggtcgtcaatgctctgaatgcggacgtctggacttatatggcggatttcgag
gactcgagtgcccctacctggtcgaacatgatcaacggccaagtcaacttgtacgatgct
atccgccgtcaggtcgacttcaagcaaggaaacaaggagtacaagctccgcacagaccgc
acccttcccaccctgattgctcgtgctcgaggctggcaccttgacgagaagcactttact
gttgacggcgagcctatctccggcagcttgttcgactttggtctttacttcttccacaac
gccaaggagctggttgctcgcggccacggtccttacttctacctccccaagatggagtcc
cacctcgaggccagactctggaatgacgtcttcaacctcgctcaggactacattggcatg
ccccggggaaccatccgtgctactgttctgattgagaccatcactgctgcgtttgagatg
gatgagattatctatgaactgcgtgaccacagctccggtctcaactgcggccgctgggat
tacatcttctccttcattaagaagttccgcaagcaccccaactttgtccttcccgaccgc
tccgacgtcaccatgaccgtgccattcatggacgcctatgtgaagctgctcatcaagact
tgccaccgccgtggtgttcacgctatgggtggtatggctgctcagatccctatcaaggac
aacgccgccgccaacgacaaggccatggagaacgtgcgcgccgacaagctgcgtgaggtc
cgtgccggccacgacggtacctgggttgctcaccccgctctcgccgccatagcctccgag
gtcttcaacaagtacatgcctacccccaaccagctgttcgtccgccgggaggacgtcaac
atcaccgccaacgatctgctcaacaccaatgtccctggcaagatcaccgaagatggtatc
cgcaagaatttgaacatcggtctttcctacatggagggctggctccgcggtgtcggctgc
atcccgatcaactacctgatggaggacgccgctaccgccgaagtttcccggtctcagctc
tggcagtgggtgcaccaccaggtcaccagctctgagggcaagaagatcgacaaggcctac
gctctgcgtctgctccaggagcaggccgacagcctggccgccaagtcacccaagggcaac
aagttccagctggcggcccgttactttgccggtcaggtgacgggtgaggactatgcggac
ttccttaccagtctgctgtacaatgagatctcgaccccgggtactgcgtcgaaattgtag

DBGET integrated database retrieval system