KEGG   Neosartorya fischeri: NFIA_050250Help
Entry
NFIA_050250       CDS       T01070                                 

Definition
2-methylcitrate dehydratase, putative
Orthology
K01720  
2-methylcitrate dehydratase [EC:4.2.1.79]
Organism
nfi  Neosartorya fischeri
Pathway
Propanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:nfi00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 558 aa AA seqDB search
MSASCSALRRLTHRSPRTLPSRIVSVSRPSSRIVARNSFTKAVNPCAPRVSQFSTMTALQ
HGAPSAPAERSYDPEIKDMADYVHNYSVNSDLAYDTARLVFLDTLGCGLEALRFKECAKL
LGPVVEGTVVPNGTRVPGTPYQLDPVNGAFNIGAMIRWLDYNDCWLAAEWGHPSDNLGGI
LAVADWISRTNRAGGNLGNGKIVKVKEVLEAMIKAHEIQGVLALENSYNRVGLDHVVLVK
VATTAVVAKMLGLNEKQTADAITQAWVDGQSLRTYRHSPNTMSRKSWAAGDACQRAVNLV
LKVQKGEGGVPTVLSAPVWGFYDVLFKGNKFKFQRPYGSYVMENVLFKVSYPAEFHSQTA
IECAQIINRKLAAMGKSAKDIKEITNRTHEACIRIIDKQFKAMDNFADRDHCVQYMVATM
LAFNRLTAEDYADGSEAATSPLVEDLRKRIRCVEDPQFTRDYHDPAKRTIPNALTVTLND
GTVLEEVVVEAPLGHRFRREEAKPEIVSKYKRHLEAHFDQARIDELLKVGLDRSSLENYD
VDKYVDLYVKDKMVVAAQ
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctcgtgttcggcgctgagacggctgacccacaggtctccccgcactttgcca
tcccgcatcgtctccgtctccaggccctcctcccgcattgtcgctcgcaactccttcacc
aaggccgtcaacccttgtgctccccgagtctcacaattctcaacaatgactgctcttcag
cacggtgctccctctgctccggcagagaggagctatgatcccgagatcaaggatatggct
gattatgttcacaactacagtgtgaactctgatttggcgtatgacactgcccgtctggtc
ttcctcgacacgctgggttgcggactggaggccttgagattcaaagaatgcgccaagctg
ttgggccccgttgttgaaggcaccgttgtccctaacggtacccgtgtccctggtactccc
taccaactggaccctgtcaatggtgccttcaacattggcgccatgatccggtggcttgac
tacaatgactgctggcttgccgccgagtggggtcacccctccgacaatctgggcggtatt
ctcgctgtcgctgactggatctcccgcaccaaccgtgccggaggtaatctcggaaatggc
aagattgtgaaggtcaaggaagtgctggaggccatgatcaaggcccacgaaatccagggt
gttctggctttggagaattcgtacaacagggtcggcctggaccacgttgtgctggtcaag
gttgccaccactgctgtggttgctaagatgctcggtcttaacgagaagcagaccgctgat
gccatcacccaggcttgggtggacggccagagtctccgtacctacagacattctcctaac
accatgtccagaaagtcgtgggctgctggtgatgcttgccaacgtgctgttaaccttgtc
ctaaaggtccagaagggcgagggcggtgttcccactgttctgtccgcccccgtctggggt
ttctatgacgttctgttcaagggtaacaagttcaagttccagcgcccgtacggcagctac
gtcatggagaacgtcctcttcaaggtttcctacccagccgagttccactctcagaccgct
attgagtgcgcgcagattatcaacaggaagctggcagctatgggcaagagcgccaaggac
atcaaggagatcaccaaccggacccatgaggcttgcatccggattatcgacaagcagttc
aaggctatggacaactttgcggaccgtgaccactgtgttcagtacatggttgccaccatg
ctggccttcaaccgcctgaccgccgaggactacgctgacggctccgaggccgccacctcg
cctttggttgaggacctgcgcaagcgcatccgctgtgtggaggacccccagttcacccgt
gactaccacgaccctgccaagcgcaccatccccaacgctctgaccgttaccctgaacgac
ggcaccgtcctcgaggaggtcgttgtcgaggctcctctaggacaccgcttcagacgtgag
gaggccaagcccgagattgtgtccaagtacaagcgccacctggaggcccactttgaccag
gcccgtattgacgagcttctgaaagttggcttggaccgttcttctctggagaactacgat
gttgacaagtacgttgacctctatgtcaaggacaagatggtcgtcgctgctcaatga

DBGET integrated database retrieval system