KEGG   Neosartorya fischeri: NFIA_051070Help
Entry
NFIA_051070       CDS       T01070                                 

Definition
calcineurin regulatory subunit CalB
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
nfi  Neosartorya fischeri
Brite
Protein phosphatases and associated proteins [BR:nfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NFIA_051070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 193 aa AA seqDB search
MEQPSEPNNAAMYDARRRRASVGTSQLLDNIVSASNFDRDEVDRLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDRDGKISFEEFTEMVE
NTDVSLSMTLSMF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacccagtgaaccaaataatgccgctatgtatgatgcacgcaggcgtagagca
tctgttgggacatcacaattattagacaacattgtctcggcttcaaacttcgacagagat
gaggtggacaggctccgcaagcgattcatgaaacttgacaaggatagctccggcaccatc
gatcgtgacgagttcctttccctcccacaagtgtcctccaacccgctcgcaacgagaatg
atcgcgatcttcgatgaagacggcggcggcgatgtcgacttccaagagttcgtgtcgggg
ctgtcggctttcagctccaagggcaacaaagaggagaagctccggttcgcgttcaaggtc
tacgacattgaccgggacggctacatctccaacggcgagctgttcatcgtgctgaagatg
atggtgggcaataacctgaaggacgtgcagctgcagcagatcgtggataagacgatcatg
gaggcggataaggaccgcgacggcaagatcagcttcgaggagttcacggagatggtggag
aataccgatgtcagcttgagcatgacactgagtatgttctaa

DBGET integrated database retrieval system