KEGG   Aspergillus fischeri: NFIA_051070Help
Entry
NFIA_051070       CDS       T01070                                 

Definition
(RefSeq) calcineurin regulatory subunit CalB
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
nfi  Aspergillus fischeri
Brite
Protein phosphatases and associated proteins [BR:nfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     NFIA_051070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 4584174
NCBI-ProteinID: XP_001257659
UniProt: A1DLU1
AA seq 193 aa AA seqDB search
MEQPSEPNNAAMYDARRRRASVGTSQLLDNIVSASNFDRDEVDRLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDRDGKISFEEFTEMVE
NTDVSLSMTLSMF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacccagtgaaccaaataatgccgctatgtatgatgcacgcaggcgtagagca
tctgttgggacatcacaattattagacaacattgtctcggcttcaaacttcgacagagat
gaggtggacaggctccgcaagcgattcatgaaacttgacaaggatagctccggcaccatc
gatcgtgacgagttcctttccctcccacaagtgtcctccaacccgctcgcaacgagaatg
atcgcgatcttcgatgaagacggcggcggcgatgtcgacttccaagagttcgtgtcgggg
ctgtcggctttcagctccaagggcaacaaagaggagaagctccggttcgcgttcaaggtc
tacgacattgaccgggacggctacatctccaacggcgagctgttcatcgtgctgaagatg
atggtgggcaataacctgaaggacgtgcagctgcagcagatcgtggataagacgatcatg
gaggcggataaggaccgcgacggcaagatcagcttcgaggagttcacggagatggtggag
aataccgatgtcagcttgagcatgacactgagtatgttctaa

DBGET integrated database retrieval system