KEGG   Aspergillus fischeri: NFIA_051560Help
Entry
NFIA_051560       CDS       T01070                                 

Definition
(RefSeq) glycosyl hydrolase family protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00052  Galactose metabolism
nfi00500  Starch and sucrose metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NFIA_051560
   00500 Starch and sucrose metabolism
    NFIA_051560
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     NFIA_051560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C BNR
Motif
Other DBs
NCBI-GeneID: 4584223
NCBI-ProteinID: XP_001257708
UniProt: A1DLZ0
AA seq 647 aa AA seqDB search
MHILPGSQHAAELGNSGTPIHPVRCDPEQKAETIPQTTGIAHVNPKWRPSYHLAAPRGWM
NDPCGLGYDPTTELYHLSFQWNPHGNDWGNISWGHATSNDLVSWQISPEPCLTPSAEYDR
CGVFTGCFRPHGPDGKPGVLTYVYTSVNHLPLHYTLPYVKGSESLSIAVSHDHGTTWQRF
DSNPIHPGAPAGLEVTGWRDPYLNCWPSLRAQRQDGVASPNLYGFISGGIAKESPTVFVY
VVNPDNLTEWTYIGPLLHVGLNYRPSRWSGDLGVNWEVANCFTLTDGGVSRDFVIFGAEG
CLSCEVGSKRVPRSLLWMCINVRPRLQAQSSCEPLAEYSFSGIFDHGCCYAANSFWDPVT
EEYVVYCWITEEDLPDRLRHRQGWSGVMSLPRLVRLVTLHHVKRAHQSKLESITSIETER
HSQGTRVRTLSIRPDPRLNILRTSARELHLSKVQLGSVAHQPPAFLPLRTARWELNATFV
IGKHCAAVGLEIGHSPGEHSRFFFPPKLQQLLTHEEDFHQRTTLSWKPYDETFTIERPSL
HDAGINHVPETAPHTLFTFCNNKGEEVTEPLQIHAYFDASVLEVSVNSRTVISTRIYTPH
AQVCTGLKFFASATESPPKPSTSAPAAVLVRADIWDGLSVIRDEIKH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgcatatccttccaggatcccaacatgcggcagagttgggcaacagtggaactccaata
caccctgttcgttgcgatccagaacagaaagccgagactatcccgcaaacgacgggtata
gctcatgtgaaccctaaatggcgaccgtcataccaccttgctgcgccccgggggtggatg
aatgacccctgtgggcttggatatgacccgacgactgaactgtaccatctgtccttccaa
tggaacccgcacgggaatgactggggcaacatctcctggggccatgccacttcgaacgat
ctagtgtcctggcaaatatcgcccgagccatgtctcacgccgtctgcggagtatgatcga
tgcggcgtgttcactggctgcttccgtcctcacggtccggatggcaagccaggtgtactt
acgtatgtatacacgtccgtaaatcaccttccactccactatactctgccgtatgtcaag
ggcagtgaatcgctcagtatagcagtctcccatgaccatggcacgacatggcaacgattc
gacagtaatccgattcaccccggcgcccctgcaggactcgaggtgacaggctggagagac
ccttatctgaactgctggccctcgttgcgggcccagcgacaagatggagtggcctccccg
aacctgtatggatttatctccgggggcattgctaaagagtccccaacagtctttgtatat
gtcgtcaatcccgacaatttgactgagtggacatatatcgggcctttgcttcatgttggc
ttaaattatcgaccctctcgatggtcgggggatctcggcgtcaactgggaagttgccaac
tgctttacgttgacagatggcggcgtctcccgagattttgtgatcttcggcgcagaggga
tgcttgtcttgcgaggttggatcaaagagagtaccgcgctccctgctctggatgtgtatt
aatgtccgacccagactgcaggcgcaaagcagttgcgagcctctcgcagaatattcattc
tcggggatcttcgatcacgggtgctgctacgccgcaaactctttctgggatccggtcacg
gaggagtacgtcgtatactgctggattacagaagaggatttaccggatcgtctgcgccat
cgacaaggctggagtggcgtcatgtctctaccgcgactagtaaggctggtgactcttcac
catgtcaagcgagcccaccagtcgaagctggaatccattacgtctatcgaaacagagcgc
cattcgcaaggtacacgggtgcgaacattgagtatccggccggaccccaggctcaacata
cttcgaacatcagcacgagagctgcatttatccaaagtacaactgggttctgtggcccat
cagccccctgcattcttgcccttgcgcactgctaggtgggaattgaacgcaaccttcgtg
attgggaagcactgcgcggcagtaggattggaaatcggccatagccctggtgagcactca
cgcttcttctttcccccaaaattgcaacaattgctgacgcacgaggaagatttccaccag
cgcaccaccctatcatggaaaccatacgacgagacgttcacaatcgaaaggccttcgctt
cacgatgccggtatcaaccatgtccccgagaccgctccgcatactctcttcaccttctgc
aacaataaaggcgaggaggtgacggaaccgcttcagatccacgcctatttcgatgcaagt
gtgctagaagtgtccgtgaatagcagaacagtcatctccacacgcatctatacaccccac
gcgcaggtctgcacggggttgaaattcttcgcctcggcaaccgaaagcccgccgaaacca
tcaacatctgctcctgctgctgtgctggtgagagcagatatttgggatggactgagtgtg
attcgtgatgaaattaagcattag

DBGET integrated database retrieval system