KEGG   Neosartorya fischeri: NFIA_052410Help
Entry
NFIA_052410       CDS       T01070                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCj, putative
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
nfi  Neosartorya fischeri
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:nfi03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 267 aa AA seqDB search
MAPSKWDDEEDSSSPPPPPVVARRKFDDEEEEDVLDSWDAAEDSEVEREKAAKAAAAAAK
AEAEAAAKKKSKAQRIEEHKQERKKQAEANESDEDSDEDEAARRARLRRTEKEGDLKHAQ
DLFDDIDLNRNRGAPKAIVISDSADPTQAVDLSAMPLFKPTTKDQFTRLTTTLIPLLTAH
SKKPHYALWAQEFTKQLVKELNSGDVKKIASALTTISNEKMREERAADKGNKKTKAAKTK
VSLVASRDNKIDATPYDDDGLDDDDFM
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcaaagtgggacgatgaggaagatagcagctcgccccctcctccccctgta
gtggccagacgcaagttcgacgatgaggaggaggaagatgttctcgactcgtgggacgcc
gccgaagactcggaagtagagcgggaaaaggccgcgaaggctgctgcggcggcagccaag
gccgaagccgaggcggcggcgaagaagaagagcaaggcgcagcggatagaggagcacaag
caggagcgaaagaaacaggccgaggcgaacgagagcgacgaggacagcgacgaggacgag
gcggcgaggcgggcccgcctgcgccgcacggagaaggagggtgacctcaagcacgcgcag
gacctgttcgacgacatcgacctgaaccgcaaccgtggagcgcccaaggcgattgtcatc
agcgactcggcggatcccacgcaggccgtcgacctctccgccatgccgctgttcaaacct
acgaccaaggaccagttcacccggctgaccacgacgctgatcccgctgctgacggcacac
tcgaagaagcctcactacgccctgtgggcgcaggagttcaccaagcagcttgtcaaggag
ctcaacagcggtgatgtcaagaagattgccagtgctctcaccactatcagcaacgagaag
atgagagaggagcgtgccgccgacaaaggcaacaagaagaccaaggcggccaagaccaag
gtgtctctcgttgctagcagagacaacaagattgatgccacaccttatgatgatgatgga
ctggacgatgacgacttcatgtga

DBGET integrated database retrieval system