KEGG   Neosartorya fischeri: NFIA_053150Help
Entry
NFIA_053150       CDS       T01070                                 

Definition
cellulase, putative
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
nfi  Neosartorya fischeri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NFIA_053150
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NFIA_053150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 329 aa AA seqDB search
MKFGSIVLIAAAAGSAVAAPAKRASVFQWFGSNESGAEFGQNTIPGSYGKEFIFPDPSTI
STLIGKGMNIFRVQFLMERLVPSSMTGSYNEEYLANLTSVVDAVTKAGSYAILDPHNFGR
YNGQIISSTDDFKTFWQNLAGKFKSNNLVIFDTNNEYHDMDQALVLNLNQAAINGIRAAG
ATSQYIFVEGNSWSGAWTWVDVNDNLKALTDPQDKIVYEMHQYLDSDGSGTSESCVSTTI
GKERVTAATKWLKDNGKVGIIGEFAGGVNDQCRTAISGMLEYLAQNTDVWKGALWWAAGP
WWGNYMFNMEPPSGAAYVGMLDILEPYLG
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcggtagcattgtgctcattgctgctgcggcaggctccgcggtggctgctcct
gcaaagagagcttcggtttttcaatggttcggaagcaatgagtctggagccgagtttggc
caaaacaccattcctggctcttatggaaaagaattcatcttcccggacccttctacaatc
agcacattgatcgggaagggcatgaacatcttccgggttcaattcctcatggagagattg
gtgccaagctctatgacaggctcctataatgaggagtaccttgccaatctgacatcggtt
gtggacgctgtcactaaggcaggatcttatgccattttggacccgcacaactttggcaga
tacaatggtcagattatctccagcaccgacgacttcaagaccttctggcagaatctggct
ggaaagttcaagtccaacaatctcgtcatctttgatactaacaacgagtatcacgacatg
gaccaggcactggtactgaacctcaaccaggccgccatcaacggtatccgcgccgcagga
gccacctcgcaatacatattcgtggagggcaactcctggagcggcgcctggacctgggtc
gacgtcaatgacaacctgaaggctctgaccgatccccaggataagatcgtctacgagatg
catcagtatctcgactcggatggatccggcacctcggagagctgcgtgtctaccacgatt
ggtaaggaacgggtcacggccgcaacgaagtggcttaaggataacggcaaggttggcatc
atcggggagttcgctggtggcgtcaatgatcagtgccggaccgctatttcaggaatgctg
gagtacttggctcagaacacggatgtgtggaagggagccctctggtgggcggctggcccc
tggtggggaaactatatgttcaacatggagcctccgagcggtgcagcttatgtgggcatg
ttggacatcttggagccctacctgggttga

DBGET integrated database retrieval system