KEGG   Neosartorya fischeri: NFIA_053440Help
Entry
NFIA_053440       CDS       T01070                                 

Definition
alanine aminotransferase, putative
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
nfi  Neosartorya fischeri
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NFIA_053440
   01210 2-Oxocarboxylic acid metabolism
    NFIA_053440
   01230 Biosynthesis of amino acids
    NFIA_053440
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NFIA_053440
Enzymes [BR:nfi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NFIA_053440
Amino acid related enzymes [BR:nfi01007]
 Aminotransferase (transaminase)
  Class I
   NFIA_053440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 495 aa AA seqDB search
MTVPYTTKRTASDLGPRRLRADNINPNVKAAKYAVRGELAVKAEEYRVRLAKGDKSLPFD
SVIFANIGNPQQLDQKPITFFRQVLSLLENTALLEKPEVLRSSFGYNQDVIDRAKKLLAD
IQSVGAYSHSQGAPLIRESVARFIEERDGFPANPQDLYLCAGASSGVSTLLNVICNAPTA
GVLVPIPQYPLYTATLSLLNAQCVPYHLEEDKAWGTDVEAIRQSLVRAKAEGTEVRAIVV
INPGNPTGASLSPEDIKSVLDIAAEEKLVVIADEVYQTNVFVGEFTSFKKRLRQLQQEVP
GKYDNVELASLHSVSKGMVGECGHRGGYFELVGFDPLVAAEIYKFVSIMLCPPVIGQCLV
ELMVNPPKKGEPSYELYQKEYNGISDGLHKRALALYEAFKQMEGVECQEPQGAMYLFPSI
TLPPKAVEAAAAEGRNADEFYCLRLLDATGVCVVPGSGFGQKENTLHFRTTFLAPGTDWV
ERIVKFHAEFMAKYK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgccatataccaccaagcggaccgcttctgatctcggccctcgtcgtctccgt
gccgataatatcaatcccaacgtcaaggcagccaagtatgctgtccgtggtgagcttgcc
gtcaaggcggaggagtaccgcgtgagattggccaagggagacaagtctttgcccttcgac
agtgtcattttcgccaatattggcaacccccagcagctggatcagaaacccatcactttc
ttccgtcaagtactcagtcttctcgagaacaccgcgttgctggaaaaaccggaggtcctg
cggtcgtctttcggctacaaccaggacgtcattgaccgggctaagaagcttctggcagac
attcagagcgtcggtgcctacagtcacagccagggagcaccattaatccgggagagcgtg
gccagattcatcgaggaacgtgatggcttccccgccaacccgcaagatctgtacctctgc
gctggtgcgtcgtccggtgttagcacgctgctgaacgtcatctgcaacgctcccaccgcc
ggtgtccttgtgccgattccccaatatcctctgtacaccgccaccctgtcccttctcaat
gcgcagtgcgtcccataccatctggaggaggacaaggcctggggtaccgacgtggaggcc
atccggcaatctctggtgcgcgccaaggccgagggcaccgaggttcgtgccatcgttgtc
atcaaccccggtaacccgacgggtgcctcgctgagccccgaggacatcaagagcgtgctt
gacatcgccgccgaggagaagctggtcgtcatcgccgacgaggtgtaccaaaccaacgtc
ttcgtgggcgagttcacatcgttcaagaagagactgcgccaactgcagcaggaggtgcct
ggcaagtacgacaacgtcgaactcgcttctctgcacagtgtgtccaagggtatggtgggc
gaatgcggtcaccgaggcggttacttcgagctcgtcggattcgaccccttggtcgcggcc
gagatctacaagtttgttagcattatgctgtgcccgccggtgatcggccagtgtctggtc
gagcttatggtgaacccacccaagaagggcgagcccagttacgagttgtatcagaaggag
tacaacggcattagcgatggcctacacaagcgtgctctcgccctgtacgaagccttcaag
cagatggagggcgtcgaatgccaggagcctcagggcgccatgtacctcttccccagcatc
accctgccccccaaggccgtcgaagccgccgctgccgaaggccggaacgccgacgaattc
tactgcctgcgcctcctcgacgccacgggtgtttgcgtggtccccggttccggctttgga
cagaaggagaacacgctccacttccgcacaaccttccttgcccccggcactgactgggtc
gagcggatcgtcaagttccacgccgagttcatggccaagtataaatag

DBGET integrated database retrieval system