KEGG   Neosartorya fischeri: NFIA_054090Help
Entry
NFIA_054090       CDS       T01070                                 

Definition
protoporphyrinogen oxidase, putative
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nfi  Neosartorya fischeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NFIA_054090
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     NFIA_054090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 603 aa AA seqDB search
MRLPCAPSLALRASRTPLAFARNGQKHSLHTGTYNAAVIGGGITGLATAFRLSQDPKCTN
ITLYEKQQRVGGWMMSETIPLGDNDGKVVFEYGPRTLRAATPACLPLLDLLVELELLEDV
LITTRSSPAAQNRYIYYPDHLVRMPGRDPGRSLFSELYSNFRTLLTEPVFDKLLRSVVTE
PLKLPPEPKSVDSDESVRDFISRRLAPEIADNIVSAVYHGIYAGDIDRLSAQTLLGTYRD
LEHDDRRVIGGLVHAATSDITYNLMDDWLALHSLAATKQKSYWSSLKTLVRDASVITFKN
GVQQLTDALAAALRKSGKVDLLTGTEVKAISTNPVNSDLTIHFGERNSNTHNRVIATNPP
PNLAQQLAKPTRSGQRLPQNSIRQLQEHNYAVSVMVVNILYENPNLLPVNGFGYLIPQSV
PFEQNPEMALGVIFGSESSVGQDTVPCTKLTVMLGGHYWDGWKTTDYPDPDTAIGMCQIL
LQRHLGITEQPLQASVKLQRQAIPQYTVGHLSRMRDLSQTVRQDFNNRLTLAGNWYNGVG
VTDCVRQAYMAASYGVGALKLDAPSFDVPWIRYNWQGWELEGGIPTSPVRITGSYRSERK
YFF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccatgtgcccctagccttgcactgagggcatcgcggacgccattggcgttc
gcccgcaatggccagaagcactcactgcataccggcacctacaacgccgcggttatagga
ggtggcatcacaggtctcgcgacggccttccgcttgtcgcaggacccaaaatgcacaaat
atcaccctgtacgagaaacaacagcgagtcgggggctggatgatgtcggaaaccatccct
ctcggcgacaatgatgggaaagttgtattcgaatatgggccaaggaccctgcgggctgcg
actcccgcgtgtctcccacttcttgacttgctggtcgagctagaattactcgaggatgtg
ttgatcacgaccaggtcgtcccccgcggcccaaaatcgctacatttactaccccgatcac
cttgttcgcatgcctggtcgcgatcccggccgtagcctgttctcagagctttactcgaac
tttcggacattgcttacggaacctgtctttgacaaactcttgcgaagtgttgtgacggag
ccactgaagctgcccccggagcccaagtctgttgactccgacgagtctgtgagggacttt
atttctcggcgacttgcccccgagatcgcagataacatagtctcggccgtgtatcatggt
atctacgccggcgatattgaccggctgagtgcgcagaccctgctgggaacctacagggac
cttgagcatgatgaccgccgcgtaattgggggccttgtacatgcagccacctcagatatc
acgtacaatctgatggatgattggctggcgctgcactcgctggctgcgacaaagcagaag
agctattggagtagtttgaagacgctggtcagagacgccagtgttatcaccttcaaaaac
ggcgtgcagcagcttactgatgccttggctgcggcattgcgcaaatccgggaaagtggac
ttattgactggtacagaggtgaaggctatcagcacaaatcccgtcaactccgatctgacc
atccacttcggagagaggaattcaaatacccataaccgcgtgattgcaacgaacccgccg
cccaacctggcacagcagttggccaagcctacaaggtcgggacagaggctgcctcaaaac
tcgattcgccaattgcaagaacacaactacgccgtgagtgtgatggttgtcaacattctg
tatgagaatcccaatctactccctgtcaacggattcgggtacttgatcccgcagtcggtt
ccgttcgaacagaatcccgagatggccctaggggtgatcttcggttccgagtctagtgta
ggtcaggacactgtgccctgcaccaagctcaccgtcatgctgggcgggcactattgggat
gggtggaagacgacagactacccagacccggataccgccattgggatgtgccaaatcctg
ctccagagacatcttggcatcaccgagcagcctcttcaggcttctgtcaaactgcaacgt
caagctattccccagtacacggtcggccatctgtcgcgcatgcgggacctttcacaaaca
gtgcgccaggatttcaataaccggctgactctggctggaaattggtacaatggcgtcggg
gtgacggattgcgttcggcaggcgtacatggctgcgtcgtatggcgttggcgcacttaag
ctcgatgcaccgagctttgatgttccctggattaggtacaactggcagggatgggaatta
gaggggggtataccaacctctcctgtgcgaataacagggtcttacaggtcggaacgcaag
tatttcttctag

DBGET integrated database retrieval system