KEGG   Neosartorya fischeri: NFIA_054120Help
Entry
NFIA_054120       CDS       T01070                                 

Definition
glycerol kinase, putative
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nfi  Neosartorya fischeri
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:nfi00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 593 aa AA seqDB search
MQPSEIFVGSIDQGTTSSRFLIFNRDGEPVASHQVEFTQIYPNPGWHEHDPFELVSSVET
CIEEAVKQFESEGYSRYSVKAIGITNQRETTVVWDHETGEPLYNAIVWTDTRPQAIVHEL
KQKREASQLQPICGLPLTTYSSATKLLWMIEHVPKVKDAYERGTLAFGTVDAWLVYRLNG
GASANVFVSDPTNASRTMFMNLETLQYDNFLLDFFGIRGKVHLPKIVPSSDAKAYGALAS
GTLAGVPIMGCLGDQSSALVGQKGFSPGMAKNTYGTGCFLLYNVGEKPVISEHGLLATVA
YHFDGKPVYALEGSIAVAGSGIKFLQNNLNFFQESKEVNDLAQTVEDSGGCVFVTAFSGL
YAPYWIDDAKGTMFGITQYTQKGHIARATLEATCFQTKAILDAMEKDSGHALSELAVDGG
MSNSDLAMQIQADLISIPVYRPKMRETTALGAAIAAGLAVGVWRNFAELRDINRAGGAVF
EPKISREESAKSFARWEKAVAMCKGWSGDEPPPPVQPSQKEIKKNAPEVVSNHNAINATP
PKFNGELTTPKFPLISISGDLDDADEEDLYLELRKIEILQRLKKLRKLKLSFY
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgcagccctcagagatcttcgtgggatcgattgatcagggtacaaccagctccagattt
ctaattttcaacagagacggtgagcctgtagcttcacatcaggtcgagtttacacagatc
taccccaatcccggatggcacgaacacgacccatttgagctggtgtcttccgttgaaacg
tgcatcgaagaggcggtcaaacagtttgaatcggagggctactcccgatacagtgtcaag
gctatcggcatcacaaaccaacgggaaactaccgtcgtttgggaccatgaaactggcgag
ccactctacaacgcgatcgtctggacagatacgcggccgcaggctatcgttcacgagctg
aagcaaaagcgcgaggcgtcgcaattgcaaccgatttgcggtcttccgctgacaacctat
tcatccgccacgaagctcctctggatgatagaacatgtgcccaaagttaaagatgcgtac
gaacgaggcacattggcgttcggtacggtagatgcgtggcttgtatatcgtttgaatggc
ggcgcatcggcaaacgtgtttgtatctgaccctacaaacgcttctcggacgatgtttatg
aaccttgagaccctccaatacgacaattttctcctggacttcttcggtatcagaggaaaa
gtccacctgcccaagattgtgccgtcttcagacgccaaagcttacggagcactggcatct
ggaacacttgctggcgttccgattatgggctgtcttggtgaccagtcctcggcgcttgta
gggcaaaagggcttttcgccaggaatggcgaagaatacctacggaacaggctgcttcctc
ctgtataatgttggagaaaagccagtcatctccgagcatggacttcttgctactgtggca
taccacttcgatggcaagccggtgtacgcccttgagggcagcattgcagtcgccggatct
ggcatcaaattcctacaaaataacttgaactttttccaagagtccaaggaagtgaacgat
ttggctcagacggtagaagacagtggaggctgtgtgtttgtcactgcgttcagtggtctt
tatgcgccttactggattgacgatgcaaaggggacaatgtttgggatcacacagtacacc
caaaagggccacattgctcgggcgacgctagaggccacctgctttcagaccaaggccatc
ttggacgcaatggagaaagacagtgggcatgcgctgtcagaattggcggttgatggaggc
atgagcaactcagaccttgcgatgcagatccaagcggatctcatctcgatcccggtgtat
cgccccaagatgcgggaaaccactgcacttggtgcggctatagccgctggtctggcggta
ggggtgtggagaaatttcgctgaactgcgagacattaaccgtgccggaggagccgtcttc
gagcccaagatcagtcgcgaagaaagcgctaagtcattcgcaagatgggaaaaggccgtc
gcaatgtgcaaaggctggtctggagatgagccaccacctccagtgcaaccttctcagaag
gagatcaagaaaaacgctcctgaggttgtatcgaaccacaacgctatcaatgctacgcct
ccaaagttcaacggagagcttaccacacccaaattccctttgataagtatttctggagac
ttggatgatgccgacgaggaagacctttatctggagctgcgaaagatcgagatcctgcag
cgactcaagaaactccggaaactcaagctttctttttactga

DBGET integrated database retrieval system