KEGG   Neosartorya fischeri: NFIA_054730Help
Entry
NFIA_054730       CDS       T01070                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
nfi  Neosartorya fischeri
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NFIA_054730
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NFIA_054730
Transfer RNA biogenesis [BR:nfi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NFIA_054730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 352 aa AA seqDB search
MSYQQERYIAELAVQRATLLTQKVFHEKAKGTVSKDDKSPVTIGDFGAQALIIQALRKNF
PNDEIVAEEEASSLREDKALSAEIWRLVKDIRLEDNESNELLGGLLPSEDAMLDIIDQGK
SAGGPKGRIWALDPIDGTKGFLRGGQYAVCLGLIEDGDVKVGAIGCPNLPVDDSVAMTAS
IGVDQTDGAGMGVLFSAIKGQGSISRPLSNGALAESKPISMRPVPDIKQAVFCEGVEAAH
SAQGDNAAVAQLLGITSPSVRLDSQAKYCSIARGAGDIYLRLPVRKDYQEKIWDHAAGDL
IVREAGGQVTDIYGQRLDFSKGRTLAANKGVVAAPKAIQDQVIGAVKTVLKL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcctaccaacaagagcgctacattgccgaactcgctgttcagcgagcaacacttctg
acacagaaagttttccacgagaaggccaagggcacagtttcgaaggacgacaaatcgccc
gtcaccatcggcgacttcggcgctcaagctctaatcatacaagccctccgcaagaatttc
cccaacgatgagatcgtcgccgaagaggaggctagctctcttcgggaggacaaggcgttg
agcgcagagatctggagactggtcaaggacatcagattggaagataacgagagcaatgag
ctcctgggtggtctcttgccaagtgaagatgcgatgctggacatcatcgaccaaggcaag
agcgcaggcggtcccaagggtcgtatctgggctctggatcccatcgatggcacaaaggga
tttctccggggcggccagtatgctgtctgtctcggcttgattgaggacggagatgtcaag
gtcggcgctattggttgccccaacttgcccgtggacgattcggttgccatgaccgccagt
atcggcgtcgaccagactgatggtgccggcatgggagtacttttctcggccatcaagggc
cagggatccattagccgacccctctcgaatggtgctcttgccgagagtaagccaatctcg
atgcgtcccgttccggatatcaaacaggccgtcttctgtgaaggagtggaggctgcccac
tccgctcaaggcgacaacgctgccgtcgctcagctcctgggtatcacctcccccagcgtg
cgactcgactcgcaggccaagtactgctcaattgctagaggcgcaggcgatatctaccta
cggctacctgtcagaaaggactaccaagagaagatctgggatcatgcggctggcgatctc
attgtccgcgaagctggtggacaagtgaccgatatctatggccagcgcttggactttagc
aagggccgcactttggctgccaacaagggagtcgtcgccgctcccaaggccatccaggac
caggtcattggtgccgtcaagacggtcctgaagctataa

DBGET integrated database retrieval system