KEGG   Neosartorya fischeri: NFIA_056240Help
Entry
NFIA_056240       CDS       T01070                                 

Definition
ceramide synthase membrane component (LAG1), putative
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
nfi  Neosartorya fischeri
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:nfi00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 440 aa AA seqDB search
MGRPRKSSHLGDIPGDTTAPAMSTMNEVSPVEGEAPKWDKALQNQVTSEKALKSQTKRRK
NRSPLRRFKDLCLKHTWVLPLLLMSVILLAYAVNPTPANPFHSAIFLSYPQPPKTPGGPV
MYGKGPLDFAFVGFYTIVLSFTREFLMQCVIRPWAGYCGIRGRGKTARFMEQVYTAMYFA
IFGPFGLYVMKQTDIWYFNTTAMFEGFPHREHVAIFKAYYLLQASYWAQQAIVLLLQLEK
PRKDFKELVGHHIITLALIGLSYRFHFTYMGIAVYITHDISDFFLATSKTLNYLDSIITI
PYFGTFVVMWIYLRHVLNLKILWAVLTEFRTVGPYELNWETQQYKCWISQIITFALLASL
QAVNLFWLFLILRILKNYIFNSVKKDERSDDETEEELEYEAESRATLATGAEQPLLTARN
TNNAPQVFVNGEPYGAKAHS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtccgcgcaaatccagccatctgggagatattccaggcgataccaccgcgccc
gccatgtcgaccatgaacgaggtcagccctgttgagggagaagctccaaaatgggacaag
gccttgcaaaaccaggtaacctctgaaaaggctctcaaatcgcagaccaagcggcgcaag
aaccgatcgcccctccgtcggttcaaggacttatgtttgaaacacacctgggttctacct
ctcctgctgatgagcgtaatcctcctcgcatacgccgttaatcccacgccggccaaccct
ttccacagcgctatcttcttgtcttacccgcaacctcccaagacccctggcggcccggtc
atgtacggaaaaggtcccttggactttgcttttgtcggcttctacaccattgtcctgtct
ttcacacgagagttcctgatgcaatgcgtgattcgcccatgggctggatactgtggcatt
cgtggcagaggaaagactgctagattcatggagcaggtctacacagccatgtactttgcg
atatttggacccttcggtttgtacgtgatgaaacagacggatatctggtacttcaacacc
acggccatgtttgagggtttccctcaccgggagcacgtcgccatcttcaaggcctattat
ctgctccaggctagttactgggctcagcaagcgattgtattgctgttgcagctcgaaaag
ccgcgaaaggatttcaaggaacttgtcggtcatcacatcatcactttggcactgatcggg
ttgagttaccggttccacttcacctatatgggcattgcggtctatatcacccacgacatc
tcagatttcttcctagcgacctcaaaaaccctcaactacctcgactccatcatcactata
ccatactttggcaccttcgtcgttatgtggatctacctccgccatgtcctcaacctgaag
atcctctgggccgtgctgaccgaattccgcaccgttggaccctacgagctcaactgggag
acccagcaatacaaatgctggataagtcagatcatcacctttgccctgctggccagtctg
caagccgtcaatctcttctggctcttcttgatcctccgcattctcaagaactacatcttc
aacagcgtgaagaaggacgagagaagcgacgacgagaccgaagaggaacttgaatatgag
gcagagagccgtgccacccttgccactggagcggagcaacctcttctcaccgctcgcaat
acaaacaatgcccctcaggtctttgtcaacggcgagccttatggcgcaaaagctcactct
tag

DBGET integrated database retrieval system