KEGG   Aspergillus fischeri: NFIA_056240Help
Entry
NFIA_056240       CDS       T01070                                 

Definition
(RefSeq) ceramide synthase membrane component (LAG1), putative
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00600  Sphingolipid metabolism
nfi01100  Metabolic pathways
Module
nfi_M00094  Ceramide biosynthesis
nfi_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NFIA_056240
Enzymes [BR:nfi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     NFIA_056240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1 Topo_C_assoc DUF5345
Motif
Other DBs
NCBI-GeneID: 4584687
NCBI-ProteinID: XP_001258172
UniProt: A1DNA4
AA seq 440 aa AA seqDB search
MGRPRKSSHLGDIPGDTTAPAMSTMNEVSPVEGEAPKWDKALQNQVTSEKALKSQTKRRK
NRSPLRRFKDLCLKHTWVLPLLLMSVILLAYAVNPTPANPFHSAIFLSYPQPPKTPGGPV
MYGKGPLDFAFVGFYTIVLSFTREFLMQCVIRPWAGYCGIRGRGKTARFMEQVYTAMYFA
IFGPFGLYVMKQTDIWYFNTTAMFEGFPHREHVAIFKAYYLLQASYWAQQAIVLLLQLEK
PRKDFKELVGHHIITLALIGLSYRFHFTYMGIAVYITHDISDFFLATSKTLNYLDSIITI
PYFGTFVVMWIYLRHVLNLKILWAVLTEFRTVGPYELNWETQQYKCWISQIITFALLASL
QAVNLFWLFLILRILKNYIFNSVKKDERSDDETEEELEYEAESRATLATGAEQPLLTARN
TNNAPQVFVNGEPYGAKAHS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtccgcgcaaatccagccatctgggagatattccaggcgataccaccgcgccc
gccatgtcgaccatgaacgaggtcagccctgttgagggagaagctccaaaatgggacaag
gccttgcaaaaccaggtaacctctgaaaaggctctcaaatcgcagaccaagcggcgcaag
aaccgatcgcccctccgtcggttcaaggacttatgtttgaaacacacctgggttctacct
ctcctgctgatgagcgtaatcctcctcgcatacgccgttaatcccacgccggccaaccct
ttccacagcgctatcttcttgtcttacccgcaacctcccaagacccctggcggcccggtc
atgtacggaaaaggtcccttggactttgcttttgtcggcttctacaccattgtcctgtct
ttcacacgagagttcctgatgcaatgcgtgattcgcccatgggctggatactgtggcatt
cgtggcagaggaaagactgctagattcatggagcaggtctacacagccatgtactttgcg
atatttggacccttcggtttgtacgtgatgaaacagacggatatctggtacttcaacacc
acggccatgtttgagggtttccctcaccgggagcacgtcgccatcttcaaggcctattat
ctgctccaggctagttactgggctcagcaagcgattgtattgctgttgcagctcgaaaag
ccgcgaaaggatttcaaggaacttgtcggtcatcacatcatcactttggcactgatcggg
ttgagttaccggttccacttcacctatatgggcattgcggtctatatcacccacgacatc
tcagatttcttcctagcgacctcaaaaaccctcaactacctcgactccatcatcactata
ccatactttggcaccttcgtcgttatgtggatctacctccgccatgtcctcaacctgaag
atcctctgggccgtgctgaccgaattccgcaccgttggaccctacgagctcaactgggag
acccagcaatacaaatgctggataagtcagatcatcacctttgccctgctggccagtctg
caagccgtcaatctcttctggctcttcttgatcctccgcattctcaagaactacatcttc
aacagcgtgaagaaggacgagagaagcgacgacgagaccgaagaggaacttgaatatgag
gcagagagccgtgccacccttgccactggagcggagcaacctcttctcaccgctcgcaat
acaaacaatgcccctcaggtctttgtcaacggcgagccttatggcgcaaaagctcactct
tag

DBGET integrated database retrieval system