KEGG   Neosartorya fischeri: NFIA_056340Help
Entry
NFIA_056340       CDS       T01070                                 

Definition
DNA polymerase delta subunit 4, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
nfi  Neosartorya fischeri
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NFIA_056340
   00240 Pyrimidine metabolism
    NFIA_056340
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NFIA_056340
   03410 Base excision repair
    NFIA_056340
   03420 Nucleotide excision repair
    NFIA_056340
   03430 Mismatch repair
    NFIA_056340
   03440 Homologous recombination
    NFIA_056340
DNA repair and recombination proteins [BR:nfi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      NFIA_056340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 193 aa AA seqDB search
MPTTRRRGGNTAASRSGQSTLSFGGKSRVTKPSATSTRSQKTKHLEPISAAVSSTEEVPD
ADQVPVAPSEPSQPHVAELAVRQQAREEIQQPLSEEDQKAIRITEQELQRYWKKEEQTRK
APRVHQEDLSLHEKILRHFDLSSQYGPCIGIARLKRWRRAKMLNLNPPIEVLAVLLKEKD
TVKQRAYVDELLS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccactcgtcgccgcggaggcaacactgccgcctcccgctcaggtcagtcgacg
ctttcattcggcggaaagtccagagtcaccaagccatcggccacgtcgacacgatctcag
aaaaccaaacacctcgaaccaatctcagctgctgtctcatcgaccgaagaggtcccagac
gcggatcaagtgcccgtcgctccctcggagccgtcacagccgcacgttgcggagctcgcc
gtcagacagcaagcccgggaggagatccagcaaccgctgagcgaggaagatcagaaggcg
atcaggatcacagaacaggagctgcagcggtattggaagaaggaagagcagacaaggaag
gcacctcgagtccaccaggaagatctttcattacacgagaagatactgagacattttgac
ctgtctagtcagtatgggccatgcatcggaattgctcggctaaagcgctggagacgtgcg
aagatgctgaacctcaatcctcctatcgaagtccttgccgtcttgctgaaggagaaggac
acggtgaagcagagagcttatgtcgatgagttgctgtcttga

DBGET integrated database retrieval system