KEGG   Aspergillus fischeri: NFIA_056830Help
Entry
NFIA_056830       CDS       T01070                                 

Definition
(RefSeq) possible replication factor-a protein
  KO
K10739  
replication factor A2
Organism
nfi  Aspergillus fischeri
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NFIA_056830
   03420 Nucleotide excision repair
    NFIA_056830
   03430 Mismatch repair
    NFIA_056830
   03440 Homologous recombination
    NFIA_056830
DNA replication proteins [BR:nfi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    NFIA_056830
DNA repair and recombination proteins [BR:nfi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     NFIA_056830
   MMR (mismatch exicision repair)
     NFIA_056830
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     NFIA_056830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MLAANRTNIARPATRPTRPEEVKWQPSQRNDGSALLLIVIIDSFPLAGIQSGFLENYYKM
DGGYNNYGNTSYGGGGGGGFMPGEMNSPAGGKGDNNNATLRPITVKQALDASQPYPEAAF
QIDGADAASVCFIGQVRNISSQSTNVTYKIDDGTGEIEVKQWIDTQTADTMETDDGKAGT
GKNQVELNGFAKVFGKIKSFGNKRYVGAHCVRPTTNLNEVHCHLLEAAAIHLFFTRGPPG
GGAAGGASGAGAGADAAMGGANDYGVGNSNLPAMSPAARRVYNLLKTEPQSNEGLHAQLI
AAKLNLPMPDVARAGEELLTAGVIFSTVDEQTWAILEY
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgcaaacaggacaaacatagcccgccccgcgacgcgtccaacacgtcccgaa
gaggtaaaatggcagccctctcagagaaatgatgggagtgctttgcttctcatagtgata
attgacagctttcccctggcgggtattcagagcggatttctcgagaactactacaaaatg
gacgggggttacaataattatggcaacacctcatacggaggtggaggcggcggtggcttc
atgcctggagaaatgaacagtccagctggtggaaagggagacaacaacaacgccaccctt
cgtccgatcacagtcaaacaagccctcgacgcctcacaaccataccccgaagccgccttc
cagattgacggagcggacgcggctagcgtctgcttcattggtcaagtccgcaacatcagc
tcacagagcacgaacgtcacatacaagatcgacgatggcacaggggagattgaagtgaag
cagtggatagacacacagaccgccgatacgatggagacggatgacgggaaagccggcacc
gggaagaaccaagtcgagctgaacggcttcgcaaaggtgtttggaaagatcaagtccttc
gggaataagcgatacgtgggagcgcactgtgtacggccgacgacgaacctcaacgaggta
cactgccaccttctcgaggccgctgcgatccatttgttctttacgcgtggtcctcctggt
ggtggagccgctggcggcgcttctggtgctggggccggcgcggacgccgcaatgggtggt
gcaaatgactacggtgttggcaacagtaatctccctgctatgagccctgccgctcggaga
gtctataacctcttgaagactgagcctcagagcaacgagggtctacacgctcagttgatt
gccgccaaattgaatctgccgatgcctgatgtagcacgggctggggaggagttacttact
gctggtgttattttctcgactgttgatgagcagacttgggcgattctggagtactag

DBGET integrated database retrieval system