KEGG   Neosartorya fischeri: NFIA_058230Help
Entry
NFIA_058230       CDS       T01070                                 

Definition
ubiquitin carboxyl-terminal hydrolase, putative
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.4.19.12]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NFIA_058230
Peptidases [BR:nfi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NFIA_058230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1337 aa AA seqDB search
MLNLGCPVLPLATAFPRVELHVRSMSANDRFGPGVAGNVSSEGHTHVVSIKVRYATFLKI
PITFLNNVHFANTHVSDRLGKTAPRLVQDLYDYDPANPPGTGRNLLSQVPPVFPEGHEGS
LDFISPSACHHQYMTKSNQSFLPQAEQKRSTGNPSKVSAVCWKCRYHLQLVVSSTPGIGQ
SSQGFADHLHHLVYKSGRQKGGASPAEISPKGQTVETFQYECSYLTCPVTVSVRIASPIL
ADEWVRLLVDPDLLRQRADEAIATHPERLEGVGRPSPITVLENLRAYISNALHNSQHSKS
ISAINKRFMTCFGVEGRPCKDLLEFLGFSVKNEGFWEPPKPNPWAEYPYQDQLKIFLDDV
VHELSALIEQRPLAERKGHQVQNTETPALSDILYAVDALDYPKALRANEFQMAPAPYYED
LGVVEDMSASSVVEAFNRQVSIDPARSPLYLQCLKSIGNLRGGDDAQTIETAVQLAYAEG
RYTHEDIVDAYRYFGLDHNDPRLTDESIIGKFYAFMSSTTQENESRIRLWRIGDSRRSER
IKSAAEDRVTNVEQAQVFLGVDSTTSDEFVLTMYTTKVNDNPATRDIARRAVELIAEARK
SAVLRHFLKTGEMTTGEMDVADAYRLLQIPDRTVDDAAIMAAYTICVDEAPGQAERYYQA
LSIIAKDKNSSLLSSMIAGPGAESGRDLSEWPVGLQNIGNTCYLNSLLQFYFSIRPFREM
VLDFESFRMELDDESLSKKRVGSREVLKKEVERSQTFLRELRTLFQHMITSPNSFVTPRP
ELARLTLISPSNEAAIRRRSTISMTRPGGLGEINGMPIMGPLGPPLPTADQTHSPTDAES
ERPKRKTTSDVDSEATLVSETTKPDTSLGPSEDKENEAPPADAMLTDIPVSQDIESNLSP
KDEMPAITFGPPNQPPPVPPRPTIQVDPQKQLLEEVEIGAQQDVTEVINNVLFQSQCAIK
PIAFAQDGEQLDQVKDLFYGRTKSYILAEAGVRSKEEWWCDIKVDVATGPRDIYSAIDGA
FDAQKVNVDDTVVEQFGAISKLPPVLQIQVQRVQFDPIKKSSFKSTHHLELKETIYLDRY
MDTQHPEIMNRRRQCWEWKNTLKTLEDRRAELLRQTETDGLDMATLFDSARAVIEDLDQL
KADPEAADDALDINPQLPSELAQLSQIAKSELNYVEQEIKDTQTMISSQFVDFKHLAYRL
YAVFVHHGSVEFGHYYIYIFDFRKNVWRKYNDTEVNEVTNTDEIFENQERQNPPTPYFLV
YVNDGLKDRLADPVCRQIFEDPAPSETIPSTEAIVHMEGVAATTLTPQQDLDMEPPAYDE
ALADTQNSGTKAVLDVK
NT seq 4014 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatttgggatgtccggttctgccgctcgcgaccgctttccctagagtggagctc
catgtgaggtcaatgagcgcaaatgaccgctttgggcctggtgttgcaggaaacgtgagc
tctgaagggcatacccatgtcgtctccatcaaggtccggtatgcaactttcttgaagata
cccatcacctttttgaataatgtgcattttgctaacacccacgtttctgaccgtctaggc
aagactgccccacggctcgtccaagatctctacgattatgatcccgccaatcctccaggc
acaggccgcaaccttctctcacaagtccctccagtcttccctgaaggtcatgaaggttca
ctcgacttcatctcgccgtcagcatgtcaccatcagtatatgacgaaatcgaaccagagc
ttcctaccccaagcggagcagaaacggagcaccggaaatccctccaaagtgtcagcggta
tgctggaagtgtcgatatcatcttcaacttgtcgttagctcgactcccggcattggtcaa
tccagtcaagggttcgcggatcacctgcatcatctggtctataaatctggaaggcagaaa
ggaggcgcttcgccagcggagatatcgcctaagggtcagactgtggaaacatttcaatat
gagtgttcatatctcacatgtcctgtgacggtgtctgtgcgaatcgcatcgccaattctt
gctgacgaatgggtgcggctgctggtagaccctgatctgctgcggcagcgggcagacgag
gctattgcgacgcatcctgagcgtttggaaggtgttggtcgaccgtcgcctattacggtt
cttgagaatcttcgcgcttacatatccaatgcccttcacaacagtcagcatagcaagtct
atatctgcgataaacaaaagattcatgacttgtttcggcgtcgaaggaaggccgtgcaaa
gacctgttggaattccttggtttttccgtgaagaatgagggattttgggagcctcccaag
ccaaatccttgggcggagtatccttatcaggatcaactgaagatatttctcgacgacgtt
gtacatgaactctccgcacttatagagcagcgaccgttggcagagaggaagggtcatcag
gtgcagaataccgaaaccccggcgttaagtgatatcctctatgcagtggatgctctagat
tatcccaaagctctgagggcgaatgagttccaaatggcgcctgcaccttactacgaagat
ttgggtgtcgtggaggacatgtcggcatcgtcagttgtggaagccttcaataggcaagtt
tccattgatccagcaaggtcaccgctttacctacagtgtctcaagtctattggaaacttg
aggggtggcgatgatgcacagaccatagaaacggcggttcaattagcctacgctgagggt
cgatacactcacgaggatattgtggatgcttacaggtacttcggacttgatcacaatgac
cctcgcctcaccgacgaaagcataattgggaagttctacgcttttatgagttctactaca
caggaaaatgaatcgcgcattcggctctggagaatcggggatagcagaagaagtgagcgt
attaagtccgcggcggaagacagggtcaccaatgttgagcaggcccaggtcttcctcggc
gtcgatagcacaacaagcgacgagttcgttctgaccatgtataccacgaaggttaatgac
aacccggcgactagggacattgcaagacgtgctgtcgagctcattgcggaagctcgaaag
tcggctgtcttgaggcattttctcaagaccggcgaaatgacaaccggggaaatggatgtt
gccgacgcctatcgcttgctccagattcctgatcgcaccgtggacgatgcagcgataatg
gcagcttacacaatttgtgttgatgaagctcctggacaagccgagcgatactatcaagcc
ttgagcatcatcgccaaggacaagaatagctctctactcagcagtatgatcgctgggccg
ggcgccgaatctggccgtgacttgtccgagtggcccgtcggactgcagaacattggcaat
acctgctatctcaatagcttactacaattttatttctccattcgcccgttccgggagatg
gtcctggactttgagagtttcaggatggagcttgatgacgagagtttgagcaagaaacgc
gttggttcccgcgaagtccttaaaaaagaggttgagcggtctcagacgttcctgagagaa
ctacggacgctgtttcaacacatgatcacttcaccaaattcctttgtgactcctcgtccg
gagttagcacgtttgacgctaataagcccgtccaatgaagcagcaattcggcgccggtcg
acgatatctatgaccagacctggcggactgggagagatcaatggcatgcctatcatgggt
cccctcggcccgcctctgccaacggcagatcaaacccatagtccaacagatgccgagtca
gaaaggcccaaacgtaaaacaacaagcgacgtggatagcgaagcgacccttgtctcggag
actaccaagccagatacgtcgttgggtcccagtgaggacaaggaaaacgaagcgcccccc
gcggatgccatgttgacagatatcccagtatcccaagatattgagagcaatctttctccc
aaagatgagatgccggctatcactttcgggccaccgaaccagccccctccagtacctccg
cgaccaacaatacaagttgatccacaaaagcagcttctggaggaggtagaaatcggtgct
cagcaggatgtcaccgaagtgatcaacaatgtccttttccagagccaatgcgcaatcaag
ccgatcgcattcgcccaggatggtgaacaacttgaccaagtgaaagacctattctatgga
cggaccaagtcatatattctcgcggaagcaggagttcggtccaaggaggaatggtggtgt
gatatcaaggtcgacgtcgcgacgggacctcgtgatatttattcagcgatcgatggcgca
tttgatgcccaaaaagtcaatgtcgatgataccgtcgtggagcaattcggtgccattagc
aagctacctccggtccttcagatccaagtgcaacgagtacaatttgacccaatcaagaag
agctcttttaagtccacgcatcaccttgaactcaaggaaacgatctaccttgatcgttat
atggacacgcagcatcctgagatcatgaatcgacgacggcagtgctgggaatggaagaat
acgctgaagacacttgaagatcgccgtgccgagctgctacgccaaaccgaaactgacggc
ctcgacatggcaaccctgttcgatagcgctagagcggttattgaagatctggatcaacta
aaggcggatcctgaagctgctgacgatgcgctcgacatcaacccacagcttccatctgag
ctagcccaactctctcagattgcaaaatccgaattgaactatgtcgaacaagagattaaa
gacacacaaaccatgatctccagccagttcgttgacttcaagcatctggcctatcggcta
tatgcggtctttgtgcaccatgggtctgtcgagtttggtcattattatatctatattttt
gatttcaggaagaatgtctggcgcaagtacaacgacactgaagtcaacgaggtgaccaac
acggacgagattttcgagaaccaagaacgccagaaccctcctaccccatactttctggtt
tacgtcaacgatggtctcaaggatcgcttggccgatcctgtttgcaggcagatttttgaa
gatcctgcacccagtgagactatcccttcgacagaagccattgttcatatggaaggggtt
gctgcgacgactttgacacctcaacaggacctggacatggaacctcctgcctacgatgag
gctctggctgatactcaaaattcaggtacgaaagctgtcctcgatgtaaagtga

DBGET integrated database retrieval system