KEGG   Neosartorya fischeri: NFIA_058670Help
Entry
NFIA_058670       CDS       T01070                                 

Definition
ubiquitin C-terminal hydrolase Ubp8, putative
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 499 aa AA seqDB search
MASITSASLLSEAEFGCEHLAAILTQSGNTAEQFKSSFLKTHNALAPRPLPLFPKPLTVD
DLPKQKGGLRTASLLRPKYTCLTCSEVCAPADRPVHTKETGHQFYMESRGRTLFCQGCGD
FVYDHDLERLRSLPYGMHQAASRRRRSSESSSDEQFVRNNANKRACAKKGVRGLYNLGQT
CYLNVILQTLLHDPILNAYFLGNGHQSHDCTLQDCIGCAVAEAFADFNSSDKAEGFAALN
LLLASWRASPTLAGYHQQDAHEYYQFLVDKLHTSTEGHVDDHDQGCSCFFHQTFYGKLKS
SVMCDNCGNITKTEDPMLDLSLDVQVQAKKRAMGGGVGPSATPTLNGCLESFTSPERLMA
GVYNCSECGGTPQKATKRLRIKKLPAILCMQLKRFEHSSAVSEKVEGRVDFPLSINMLPY
TTHRHSEDLDKSKFVYDLSSAVVHKGKLDAGHYYVYCKQGDQWVLFNDDQVTAATEAEVL
NVDAYLLFYNLRLFTASLQ
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctagcattacttcagcgtcccttctctcggaggctgagttcggttgcgagcatctc
gccgcaatactgactcagagtggaaacactgccgagcagttcaagagctcgttccttaaa
acgcacaatgctctggctcctaggccattacctctgtttcctaagcctttgacggtggat
gatctcccgaagcaaaagggaggcctgcgtactgcttctctgctaaggccaaaatacacg
tgcttgacttgctctgaagtgtgcgcccctgccgatagaccagttcatacgaaagagact
gggcatcagttctacatggagtcaagggggcgtactctgttctgccaaggttgcggtgac
ttcgtctatgaccatgacttggaacgtcttcgatcgttaccttatggaatgcatcaagca
gcatccaggagacgtagatcaagcgaaagttcatcggatgaacagtttgtcaggaacaac
gccaacaagcgcgcttgtgcgaaaaagggcgtccgaggtctgtacaatctcggacaaaca
tgttatctcaacgtcatcctgcaaactttactgcatgatcccatcttgaatgcctatttc
ttggggaatggccatcagtcacacgattgtactctccaggattgcataggctgcgcagtt
gcagaagcatttgccgacttcaacagcagcgacaaagccgaaggctttgccgcattgaat
cttcttctagcatcatggcgtgcaagtcctactttggcaggttaccatcagcaggacgca
cacgagtactaccaattcctcgtcgacaagttacatacgagcactgaaggacacgtggat
gaccacgaccaagggtgttcttgctttttccaccaaacattttatggcaagcttaaaagt
agtgtgatgtgcgataattgcggcaacattacaaaaacggaagatcctatgctcgatctg
agtctggacgttcaggtacaggcgaagaaacgggccatgggcggtggtgtcgggccctca
gcgacacctacactaaatggttgcctggagagctttacatctccagaaaggctgatggca
ggtgtctacaattgcagtgagtgtggcggtacgcctcagaaagcaacaaagcgtttgcga
atcaagaaattgccggcgattctctgcatgcagctgaagcgcttcgagcatagctcagca
gtgtccgagaaagtggaaggcagggtcgatttccctttgtcgatcaacatgctcccatat
acaacacatcggcacagtgaggatcttgacaaatccaaattcgtctatgatctctcttct
gccgttgtccacaaaggcaaattggacgctggacactactacgtctactgcaagcagggc
gaccagtgggtactgttcaacgatgatcaagtcactgccgccaccgaggctgaagtcctc
aacgtcgatgcgtatctcttattttacaatctacgattgtttactgcttctttgcagtag

DBGET integrated database retrieval system