KEGG   Neosartorya fischeri: NFIA_058760Help
Entry
NFIA_058760       CDS       T01070                                 

Definition
uroporphyrinogen-III synthase (UroS), putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nfi  Neosartorya fischeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nfi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MTTSPSYAFSSSSATPILLLKTKSTPHDGYEEFFSAHGYNPAFVPVLEHHFNQTNLHTVK
DLFTSGSLNAGPRRKYGGLIFTSQRAVEGFARLVTSEVDVSIATAASQSLILYTVGPATS
RSLTTLRDSHLPHATIYGSDAGDGQKLALAILEHYNALYDGGGVDAGAGAPPAKPPLLFL
VGEQRRDIIPRTLMDESLSPAKRIQVNELVVYETGVMESFGGDFQAAVRAGQEYLALAGQ
DGDGDGEEGVIWVVVFSPTGCDAMLRVLGLLSSSTDSSAGGAGALVDGSASGTERRVFIA
TIGPTTRDHLVKNYGFQPDVSAEKPSPEGVGAGIEAFMRRRKGI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcaccttcatatgccttctcatcctcatcagcaacgcccatactgctcctc
aagacgaaatctaccccgcacgatggctacgaggaattcttctccgcccatggctacaac
cccgccttcgtcccagtcctcgagcaccatttcaaccagacgaacctccacaccgtaaag
gatctcttcacatcaggcagtctaaatgccggcccgcggcgaaaatacggcgggctgata
ttcaccagccagcgcgctgtagaggggttcgcacgcttggtcacgagcgaggtagatgtt
tcaatagcgacagccgcatcccaatccttgatactgtacactgtcgggcccgcgacatcc
cgctccctcactaccttgcgagactcacatctgccccatgcgactatctacggctccgac
gctggagacggccagaaacttgcgcttgcgattctggagcattataatgcgctttatgat
ggcggaggcgtagatgctggcgcaggcgcaccgcccgcgaagccacccctcctcttcctt
gttggcgaacagcgccgcgatatcatacccagaacgctcatggatgagtccctgtccccc
gctaagcggattcaggtgaatgagcttgtcgtttacgagacgggggtaatggagtccttt
ggaggtgattttcaggctgcggtgcgcgccggacaggagtatttggctctggctggtcag
gacggggacggggatggggaggagggggtgatctgggttgtggtgttttcgccgacgggc
tgtgatgcgatgcttcgcgttctagggttgctttcttcgtctacagattcctctgccgga
ggtgcgggtgcgctggttgatgggagtgcaagcgggacggagaggagggtcttcatagca
actatcgggcctacgacgagagatcatcttgtcaagaattatggattccagccggatgtt
tccgcggagaagcctagtccggaaggtgttggtgctggcattgaagcgttcatgcggcgg
aggaaggggatatga

DBGET integrated database retrieval system