KEGG   Neosartorya fischeri: NFIA_058760Help
Entry
NFIA_058760       CDS       T01070                                 

Definition
uroporphyrinogen-III synthase (UroS), putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nfi  Neosartorya fischeri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NFIA_058760
Enzymes [BR:nfi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     NFIA_058760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MTTSPSYAFSSSSATPILLLKTKSTPHDGYEEFFSAHGYNPAFVPVLEHHFNQTNLHTVK
DLFTSGSLNAGPRRKYGGLIFTSQRAVEGFARLVTSEVDVSIATAASQSLILYTVGPATS
RSLTTLRDSHLPHATIYGSDAGDGQKLALAILEHYNALYDGGGVDAGAGAPPAKPPLLFL
VGEQRRDIIPRTLMDESLSPAKRIQVNELVVYETGVMESFGGDFQAAVRAGQEYLALAGQ
DGDGDGEEGVIWVVVFSPTGCDAMLRVLGLLSSSTDSSAGGAGALVDGSASGTERRVFIA
TIGPTTRDHLVKNYGFQPDVSAEKPSPEGVGAGIEAFMRRRKGI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcaccttcatatgccttctcatcctcatcagcaacgcccatactgctcctc
aagacgaaatctaccccgcacgatggctacgaggaattcttctccgcccatggctacaac
cccgccttcgtcccagtcctcgagcaccatttcaaccagacgaacctccacaccgtaaag
gatctcttcacatcaggcagtctaaatgccggcccgcggcgaaaatacggcgggctgata
ttcaccagccagcgcgctgtagaggggttcgcacgcttggtcacgagcgaggtagatgtt
tcaatagcgacagccgcatcccaatccttgatactgtacactgtcgggcccgcgacatcc
cgctccctcactaccttgcgagactcacatctgccccatgcgactatctacggctccgac
gctggagacggccagaaacttgcgcttgcgattctggagcattataatgcgctttatgat
ggcggaggcgtagatgctggcgcaggcgcaccgcccgcgaagccacccctcctcttcctt
gttggcgaacagcgccgcgatatcatacccagaacgctcatggatgagtccctgtccccc
gctaagcggattcaggtgaatgagcttgtcgtttacgagacgggggtaatggagtccttt
ggaggtgattttcaggctgcggtgcgcgccggacaggagtatttggctctggctggtcag
gacggggacggggatggggaggagggggtgatctgggttgtggtgttttcgccgacgggc
tgtgatgcgatgcttcgcgttctagggttgctttcttcgtctacagattcctctgccgga
ggtgcgggtgcgctggttgatgggagtgcaagcgggacggagaggagggtcttcatagca
actatcgggcctacgacgagagatcatcttgtcaagaattatggattccagccggatgtt
tccgcggagaagcctagtccggaaggtgttggtgctggcattgaagcgttcatgcggcgg
aggaaggggatatga

DBGET integrated database retrieval system