KEGG   Aspergillus fischeri: NFIA_063220Help
Entry
NFIA_063220       CDS       T01070                                 

Definition
(RefSeq) palmitoyl-protein thioesterase precursor
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00062  Fatty acid elongation
nfi01100  Metabolic pathways
nfi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    NFIA_063220
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     NFIA_063220
Lipid biosynthesis proteins [BR:nfi01004]
 Fatty acid synthase
  Component type
   NFIA_063220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest DUF915
Motif
Other DBs
NCBI-GeneID: 4589646
NCBI-ProteinID: XP_001263058
UniProt: A1D617
AA seq 324 aa AA seqDB search
MPMHYLTTLLPLTLAILSAASPLRPHETELTPLPLVIWHGLGDDFQRDGMKEVAALAEST
NPGTYVHLIHLGDTASADRQATFLGNLTEQIALVCDQLRADPILSTAPAVNALGFSQGGQ
FLRGYVERCNDPPVRNLVTFGSQHNGIAEFQECAWSDWICRGAEALLRAGRWSSLAQSRF
VPAQYFRDPEELEAYLEHSNFLADINNERVLKNERYAENLAGLNRFAMYMFEDDTMVNPK
ESAWFAEVNRTNGEVTPLKDRRLYKEDWLGLKALDEQGKLDFRTVPGGHMQLAEETLEKV
FKEYFGPVEVEIPPDNTLLKQTGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcactacctaacgaccctcctccccctcaccctcgcaatcctctccgcagca
tctcccctccgcccccatgaaacagaactcaccccgctcccgctagttatctggcacggc
ctcggcgacgacttccagcgcgacggcatgaaagaagtcgccgcgctcgccgagtccaca
aaccccggaacctacgtccacctcatccacctcggcgacaccgccagcgccgaccgtcag
gccaccttcctcggcaacctcaccgagcaaatcgcactcgtctgcgaccagctccgcgca
gatccgatcctttcgaccgcccccgcggtcaacgcgctgggcttctcgcaaggcgggcag
ttcctgcgcgggtacgtcgagcggtgcaacgacccgcccgtccgcaacctcgtcaccttc
ggcagccagcacaacgggatcgccgagttccaggagtgcgcgtggagcgattggatctgc
cggggggcggaggcgctgctgcgcgcgggccggtggtcgagtctcgcgcagtcgcggttc
gtgcctgcgcagtacttccgcgatccggaggagctggaggcgtacctcgagcatagcaac
ttccttgcagacataaacaacgagcgtgtgttgaagaatgaaaggtacgcggagaatctg
gcggggttgaatcgctttgcgatgtatatgtttgaggacgataccatggtgaatccgaag
gagagtgcgtggtttgcggaggtgaataggacgaacggcgaggtgacgccgcttaaggac
aggcggttgtataaggaggactggttggggttgaaggcgctggatgaacagggaaagctg
gactttaggactgttcccggtggtcatatgcagctggctgaggagaccctggagaaggtc
ttcaaggagtattttgggccggtcgaggtggagattcctccggataatactctgctcaag
cagactggcttgtag

DBGET integrated database retrieval system