KEGG   Neosartorya fischeri: NFIA_063220Help
Entry
NFIA_063220       CDS       T01070                                 

Definition
palmitoyl-protein thioesterase precursor
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
nfi  Neosartorya fischeri
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NFIA_063220
  Lipid metabolism
   00062 Fatty acid elongation
    NFIA_063220
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     NFIA_063220
Lipid biosynthesis proteins [BR:nfi01004]
 Fatty acid synthase
  Component type
   NFIA_063220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MPMHYLTTLLPLTLAILSAASPLRPHETELTPLPLVIWHGLGDDFQRDGMKEVAALAEST
NPGTYVHLIHLGDTASADRQATFLGNLTEQIALVCDQLRADPILSTAPAVNALGFSQGGQ
FLRGYVERCNDPPVRNLVTFGSQHNGIAEFQECAWSDWICRGAEALLRAGRWSSLAQSRF
VPAQYFRDPEELEAYLEHSNFLADINNERVLKNERYAENLAGLNRFAMYMFEDDTMVNPK
ESAWFAEVNRTNGEVTPLKDRRLYKEDWLGLKALDEQGKLDFRTVPGGHMQLAEETLEKV
FKEYFGPVEVEIPPDNTLLKQTGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcactacctaacgaccctcctccccctcaccctcgcaatcctctccgcagca
tctcccctccgcccccatgaaacagaactcaccccgctcccgctagttatctggcacggc
ctcggcgacgacttccagcgcgacggcatgaaagaagtcgccgcgctcgccgagtccaca
aaccccggaacctacgtccacctcatccacctcggcgacaccgccagcgccgaccgtcag
gccaccttcctcggcaacctcaccgagcaaatcgcactcgtctgcgaccagctccgcgca
gatccgatcctttcgaccgcccccgcggtcaacgcgctgggcttctcgcaaggcgggcag
ttcctgcgcgggtacgtcgagcggtgcaacgacccgcccgtccgcaacctcgtcaccttc
ggcagccagcacaacgggatcgccgagttccaggagtgcgcgtggagcgattggatctgc
cggggggcggaggcgctgctgcgcgcgggccggtggtcgagtctcgcgcagtcgcggttc
gtgcctgcgcagtacttccgcgatccggaggagctggaggcgtacctcgagcatagcaac
ttccttgcagacataaacaacgagcgtgtgttgaagaatgaaaggtacgcggagaatctg
gcggggttgaatcgctttgcgatgtatatgtttgaggacgataccatggtgaatccgaag
gagagtgcgtggtttgcggaggtgaataggacgaacggcgaggtgacgccgcttaaggac
aggcggttgtataaggaggactggttggggttgaaggcgctggatgaacagggaaagctg
gactttaggactgttcccggtggtcatatgcagctggctgaggagaccctggagaaggtc
ttcaaggagtattttgggccggtcgaggtggagattcctccggataatactctgctcaag
cagactggcttgtag

DBGET integrated database retrieval system