KEGG   Aspergillus fischeri: NFIA_064110Help
Entry
NFIA_064110       CDS       T01070                                 

Definition
(RefSeq) aldose 1-epimerase, putative
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00010  Glycolysis / Gluconeogenesis
nfi00052  Galactose metabolism
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
nfi01130  Biosynthesis of antibiotics
Module
nfi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_064110
   00052 Galactose metabolism
    NFIA_064110
Enzymes [BR:nfi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NFIA_064110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 4589665
NCBI-ProteinID: XP_001263144
UniProt: A1D6A3
AA seq 411 aa AA seqDB search
MHVKHYLSAVLYGLPVLAQSTESSSSSSSSTSATDPFKVYTISAENITAKLIPYGARLIS
LMVPDRDGKEQDVVIGYDDPEAYLNDTETVHTFFGAVVGRYANRIKNGTFTIGSNEYHVP
ENENNGTDTLHGGKVGYDQRNWTVTAHSKSSVTFTLFDQGWEDFPGDVITHAVYSVDTTV
TPQNPKGLPQLTTKLISLALTEATPIMLSNHIYWNLNAFKAPNVLDDTFLQLPYSNRLIA
TDGILIPNGTILTVDAFNGAPDFTEGKLIGADLKDTYGMCGTDCTGYDTCWLVDRPPQYA
APDSLVPIVRMNSSATGISLEVSSNMPALQIYTCDNAKMDYLPIKPSQEKRNKEEGKEGA
KNVMQYGCVVIEPEGWIDGINHPEWGQLPLQIFSPNDGPAVNWATYQFGTV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcacgtcaagcactatctctcggccgtcctttatggactgccagttttggctcagagt
acagagtcgagctcctcttcttcgtccagcacttcagctacagatcccttcaaggtctac
accatcagcgcggaaaacatcactgccaagctgattccgtatggagcacgactgatatcg
ctgatggtcccggatcgcgatggcaaggagcaggatgtcgtcattggctacgatgaccct
gaggcctacctgaatgatacagagacagtccacaccttcttcggtgctgttgttggtcgg
tacgccaatcgcatcaagaacggcacgttcaccatcggcagtaatgagtaccatgtgccg
gagaatgagaacaacggcaccgacaccctccacggaggcaaggtaggctacgaccaacgg
aactggactgtcacagcacactccaagtcttccgtcaccttcactctcttcgatcaaggt
tgggaggacttccccggagacgtcatcacccacgccgtctacagtgtcgacacgactgtc
actccgcaaaacccaaagggtctcccccaactgaccaccaaactgatctcccttgccctg
acggaggcgaccccaatcatgctctccaaccacatctactggaacctcaatgcgttcaag
gcccctaatgtcctggatgacaccttcctgcaactcccttactccaaccgcctcatcgcc
acagatggcatcctcatccccaatggcaccatcctcaccgtcgatgcgttcaatggcgcc
cccgatttcaccgagggcaagctcatcggcgccgatctcaaggatacctacggcatgtgc
ggcacagactgcaccggctacgatacctgctggctcgtcgaccgaccccctcaatacgca
gctccggactcactcgtccccatcgtccgcatgaactccagcgcaaccggaatcagcctc
gaagtgtcgtccaacatgcccgctcttcaaatctacacctgcgacaacgccaagatggac
tacctccccatcaagccgtcccaggagaagcgtaacaaggaagagggcaaggaaggcgca
aagaacgtcatgcagtatggctgcgtggttatcgagcccgagggctggattgatggcatc
aaccaccctgaatggggacaattgccgctgcagatcttctctcccaacgatggtccagcc
gtcaactgggctacttatcaattcggcactgtctag

DBGET integrated database retrieval system