KEGG   Neosartorya fischeri: NFIA_065020Help
Entry
NFIA_065020       CDS       T01070                                 

Definition
glutathione peroxidase Hyr1, putative
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nfi  Neosartorya fischeri
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NFIA_065020
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NFIA_065020
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NFIA_065020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 195 aa AA seqDB search
MASATTFYEFKPVDKKGEPFDLASLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHP
EDFTILGFPCNQFGSQDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVWTWMKETM
PGLMGLKRVKWNFEKFLISADGKVVGRWASITKPESLEATILKEIEKAKKEGTAASTRKG
EGEATEQATEQAKLS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcgacgacattctacgagttcaagcccgtcgacaagaagggcgaacccttc
gacctcgcctccctgaaaggcaaagtcgtcctcgtcgtcaacaccgcctccaaatgcggc
tttacccctcaattcaaaggccttgagaacctctaccagtccatcaaggcaaagcaccct
gaagacttcaccattctcggcttcccctgcaaccaatttggcagccaagaccccggctcc
aacgacgagatccagtccttctgccaggtcaactacggcgtcaccttccccgtgctgggc
aagttggatgtcaacggcgacaatgcggcgcccgtgtggacgtggatgaaggagacgatg
cctggacttatggggctgaagcgcgtcaagtggaatttcgagaagtttttgatttccgct
gatgggaaggtcgttgggcgctgggctagtattaccaagcctgagtcgctggaagcaacg
atcctgaaggagattgaaaaggcgaagaaggaggggacggccgcttcgacgaggaagggt
gagggagaagctaccgagcaggctactgagcaggctaagttgtcgtag

DBGET integrated database retrieval system