KEGG   Neosartorya fischeri: NFIA_065020Help
Entry
NFIA_065020       CDS       T01070                                 

Definition
glutathione peroxidase Hyr1, putative
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nfi  Neosartorya fischeri
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nfi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nfi00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 195 aa AA seqDB search
MASATTFYEFKPVDKKGEPFDLASLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHP
EDFTILGFPCNQFGSQDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVWTWMKETM
PGLMGLKRVKWNFEKFLISADGKVVGRWASITKPESLEATILKEIEKAKKEGTAASTRKG
EGEATEQATEQAKLS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcgacgacattctacgagttcaagcccgtcgacaagaagggcgaacccttc
gacctcgcctccctgaaaggcaaagtcgtcctcgtcgtcaacaccgcctccaaatgcggc
tttacccctcaattcaaaggccttgagaacctctaccagtccatcaaggcaaagcaccct
gaagacttcaccattctcggcttcccctgcaaccaatttggcagccaagaccccggctcc
aacgacgagatccagtccttctgccaggtcaactacggcgtcaccttccccgtgctgggc
aagttggatgtcaacggcgacaatgcggcgcccgtgtggacgtggatgaaggagacgatg
cctggacttatggggctgaagcgcgtcaagtggaatttcgagaagtttttgatttccgct
gatgggaaggtcgttgggcgctgggctagtattaccaagcctgagtcgctggaagcaacg
atcctgaaggagattgaaaaggcgaagaaggaggggacggccgcttcgacgaggaagggt
gagggagaagctaccgagcaggctactgagcaggctaagttgtcgtag

DBGET integrated database retrieval system