KEGG   Neosartorya fischeri: NFIA_065870Help
Entry
NFIA_065870       CDS       T01070                                 

Definition
arginase, putative
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
nfi  Neosartorya fischeri
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NFIA_065870
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NFIA_065870
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     NFIA_065870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 324 aa AA seqDB search
MTAPSTIKQRFLSKPNELGVVAVGFNGGQCKLGVEAAPLALIEAGLLNQVRDDLGYQLHY
DDTVHYYESLTPMSDPDHRGMKKPRAVSVVTETLSKQVYDYAKDGKFVLTLGGDHSIAIG
TISGTAKAIRERLGREMAVIWVDAHADINTPEMSPSGNIHGMPMAFLTRLAREDKKDIFG
WLQDEHIINKNKLVYIGLRDVDRGEKQLLREHGIKAFSMHDIDRHGIGRVVEMALAHIGN
DTPIHLSFDVDALDPQWAPSTGTPVRGGLTLREGDFICECVHETGNLVAMDLVEVNPSLE
EVGASETIRAGCSLVRCALGDTLL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgccatcaactatcaagcaaagattcctgtccaagccaaatgagctgggcgtg
gtcgctgtcggatttaacggtggtcagtgcaaactaggcgtcgaagcagccccgctcgcc
ttgattgaagccggtcttctgaatcaagtgcgcgacgacctgggctaccaacttcactat
gacgacaccgtgcactactacgagagcctgacccccatgagcgatcccgatcaccggggc
atgaagaagccgcgcgccgtgagcgttgtgaccgagacgctcagcaagcaggtctacgac
tacgccaaggacggcaagttcgtcctcacgctaggcggcgaccactcgatcgccatcggc
accatctccggcacggccaaggccatccgggagcgactgggccgcgaaatggcggtcatc
tgggtcgatgcgcatgccgatatcaacacgccggagatgagccccagcgggaacatccac
ggcatgcccatggccttcttgacgcgactggcccgggaggacaagaaggatattttcggg
tggttgcaggatgagcacatcatcaacaagaacaagctggtgtacatcggtctgcgggat
gtggaccgcggcgagaagcagctgctgcgggagcatggtatcaaggcattcagcatgcat
gacattgacagacatggaatcggtcgcgtggttgaaatggcgctcgctcacatcggcaac
gacacccccatccatctctcgttcgacgttgacgccttggaccctcaatgggcccctagc
acaggcactcccgtccgtggaggtctgactctgcgtgagggtgacttcatctgcgaatgt
gttcacgagactggcaacttggtcgccatggatctggtagaggtcaaccccagcctggag
gaagtcggtgcttcagagaccatccgagccggttgctctttggtgcgttgcgcactgggc
gacacactgctgtga

DBGET integrated database retrieval system