KEGG   Neosartorya fischeri: NFIA_067910Help
Entry
NFIA_067910       CDS       T01070                                 

Definition
carboxylesterase
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     NFIA_067910
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     NFIA_067910
    3.1.1.84  cocaine esterase
     NFIA_067910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MPPFAFKGLALITLGATVAQAQLWDQIIQTNYGPVQGFKYFNESTLEKFFGVSESNVTAF
LGIPFAADTGYQNRWKPPQPREPWNETLKATKFGPRCPTDESSYISEDCLSLNLWTNAGS
ADAKLPVMVWNQGSDETSDQSWWYGGGMALKDVILITFNRRDDVFGYLAHPDLNAEGLAV
TGHNTSGNYGVLDQLEVLKWVKKNIANFGGDPDRVVVAGQSFGSSQVYHAVNSPLFKGYF
HGGISQSGIRYPYDPLLAGLATSYVNMSTALIHGADYIAAHNVSSIAELRTLSMEELLVG
SQDRVNSTWISWVTALSAGYPLIFKPVLDNYVLPSKYIETLLNGPANDVPVITGNTKDES
GASPSTDYTVEKYENYTSHKYGDLYNRYIKLYPDNGNQSTADRSWNAAARDASLVGSWAY
ATEWYKAASAPFYTYYWTHAPPGQNQGAFHQSEIMYALNALYANADQYPFTEADYEIQEK
MSAYWANFAKTLNPNKGGSYKGKGVLPHWSPNSPNGTQVVMELGNAFANVPIAKREQVEF
LMEWYHRQIPY
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcccccattcgcgttcaagggcctcgccttgataaccctgggcgctacagtcgcccaa
gcccagctctgggaccaaatcattcagaccaactatggcccggtccaaggcttcaagtac
ttcaacgagtctacgcttgagaaattctttggcgtctcggagtccaatgtgacggctttc
ttaggcatcccctttgccgcggataccggttatcaaaaccgctggaaacccccccagcca
cgcgaaccgtggaatgaaactttgaaggccaccaagtttggccctcgttgtcccaccgat
gagtccagttacatcagcgaagattgcctgagtctgaacctatggactaatgccggctcc
gcggatgctaagctgcctgtcatggtctggaaccagggctcggatgagaccagcgatcaa
tcctggtggtatggcggcgggatggccctgaaggatgtcatcctcattaccttcaaccgc
agagatgatgtgttcggatacctggcgcatccggatctgaatgcagagggtctggcagtc
actggtcacaatacatccgggaactatggtgttcttgatcaacttgaggtgctgaaatgg
gtgaagaagaacatcgccaacttcggtggtgaccctgaccgggtggtagtggccggtcag
tcctttggctcttcccaggtgtaccatgctgtgaacagcccactgttcaaaggctatttc
catggtggcatctctcagtctggcatccgatacccatatgacccactgctggctggcctc
gcgacttcttatgtcaacatgtccacggctcttatccacggtgccgactacattgctgcc
cataatgtctctagcatcgccgaattgcggacattgtccatggaggagctgctggtcggc
tcgcaggaccgtgtcaacagcacttggatctcctgggtcactgccctgtccgctggctat
cccttgatcttcaagcctgtcctcgacaactatgtcctcccctccaagtacatcgagacg
ctcctcaacggacccgccaacgatgttcccgtcatcacaggcaacacaaaggacgagtct
ggcgcatccccctccaccgactacaccgtggagaaatacgagaactacacctcgcacaaa
tacggcgacctctacaaccgctacatcaagctgtacccggacaacggcaaccaaagcacc
gctgatcgatcctggaacgccgcggcccgcgacgcctcccttgtcggttcatgggcctac
gccaccgagtggtacaaggccgcatccgccccgttctacacctactactggacccacgcc
ccgcccggccagaaccaaggcgccttccaccagtcggagatcatgtacgccctgaacgct
ctatacgccaatgccgatcagtaccctttcaccgaagcggactatgagatccaggagaag
atgtccgcctactgggccaactttgcaaagacattgaatcctaacaagggcggctcttac
aagggcaagggagtgttaccgcactggagtcctaatagcccgaatggcacccaggtggtt
atggaacttggcaatgcgttcgctaatgtgcccattgccaagagggagcaggttgagttt
ctgatggagtggtaccaccggcagattccatattag

DBGET integrated database retrieval system