KEGG   Neosartorya fischeri: NFIA_068150Help
Entry
NFIA_068150       CDS       T01070                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nfi  Neosartorya fischeri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nfi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nfi00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:nfi00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 536 aa AA seqDB search
MSHTLSQKYLSTRGASYGLSFEDVVLKGLASDGGLFIPEEIPSLPAGWETEWRDLSFEDL
AYRIMSLYISPSEIPSEDLKDIIRRSYATFRHPERTPVVELDEKRNLYLLELFHGPTFAF
KDVALQFLGNLFEYFLVRKNEGKEGKDRHHLTVIGATSGDTGSAAIYGLRGKKDVSIFIL
FPTGRVSPIQQAQMTTVLDANVHNLTVEGSFDDCQDIVKALFADPDLNSTHNIAAVNSIN
WARILAQITYYFYSYFSLTKTPGFSKDTKMRFVVPSGNFGDILAGWFAKRMGIPAEKLVI
ATNENDILDRFFRSGGQYTKNTTQAEGVKETHSPAMDILVSSNFERLLWFLAFQADGAGS
ADERRKHACESVSNWLNQLKTQGGFTVPQAVLEGAKAEFESERVSNDETIDQIKSTYTSS
FPSNLGPGSAKSSKTGGYILDPHSAVGVRAALRSIERNPGVKHISLSTAHPAKFASAVDL
ALRAEDGYDFTEVLPQEFIGLEQRESRVTPIRAGAGWVGVREVVKAEVEQELQGLR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatacgctttcgcaaaaatatctcagcacgcggggtgcctcctacgggctgtcc
ttcgaagatgtcgtccttaaaggattggcgtccgatggtggcctgttcatccccgaagaa
atcccctcgcttcctgcgggatgggagacggagtggcgcgatctcagtttcgaagatctc
gcatatcgtatcatgtcgttgtacatctcgccgagtgaaatcccctcggaagacctcaaa
gatatcattagacgttcatacgctacattccggcaccctgagcggacgcctgtggttgaa
ttggacgaaaaacgcaacctctacttgctcgaattgttccatggaccaacatttgccttc
aaggatgtagcgctacagttcctcggaaacctcttcgaatatttcttggtgcgcaagaat
gagggcaaggagggcaaggacagacaccacttgactgttattggtgccaccagtggagat
actggatcggcagccatctatggtctccggggcaagaaggatgtctccatcttcatcctc
ttccccactggacgggtgtcgcctatccagcaagctcagatgacgacagtcttggacgcc
aacgtccacaacctgacagtcgagggctctttcgatgattgccaggacattgtcaaggcc
ttgtttgccgatcctgatctcaactcaacccacaacattgccgctgtcaactccatcaat
tgggctcgtatcctggcccagatcacatactacttctactcctacttctctctcaccaag
acccccggcttctccaaagacacgaagatgcgcttcgttgttccttcaggaaatttcggt
gacattctcgccggatggttcgctaagcgcatgggcattcccgctgagaagcttgtcatc
gcaaccaacgagaacgacatcctggatcgcttcttccgtagtggtggccagtacaccaag
aacaccacacaggcagaaggcgtcaaggagactcacagccccgccatggacatcctcgtc
agcagcaactttgagcgtctcctctggttccttgcgttccaggcggacggcgccggctct
gcagacgaaagacgcaagcacgcctgcgagagcgtcagcaattggctcaatcagctcaag
acacagggtggcttcaccgtaccccaggcagtccttgagggcgccaaggccgagttcgag
agcgagcgggtgagcaacgatgagaccattgaccagatcaagtccacctacacctcttcc
ttcccctccaatctcggccccggcagcgccaagagctccaagactggcggctacattctc
gaccctcactcggctgtcggtgtgcgggcagctctgcgctctatcgagcgtaatcctggt
gtcaagcacatctccctctccacagcccacccggccaagttcgccagcgccgtcgacctg
gcccttcgcgccgaagacgggtatgacttcaccgaggttcttccccaggaattcatcggg
ctcgagcagcgcgaaagcagagtcactcctatccgcgccggcgccggatgggtaggtgtc
cgggaagtggtcaaggccgaagtcgagcaggagctgcagggcttgaggtag

DBGET integrated database retrieval system