KEGG   Neosartorya fischeri: NFIA_068390Help
Entry
NFIA_068390       CDS       T01070                                 

Definition
endosome-associated ubiquitin isopeptidase (AmsH), putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
nfi  Neosartorya fischeri
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NFIA_068390
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NFIA_068390
Peptidases [BR:nfi01002]
 Metallo Peptidases
  Family M67
   NFIA_068390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MASHAPTPSMGASPPQSVEKITRIAQDYEYNPLIPLRNWLRTASTLLREARIYEREGHDE
QTYLLLFRHAQLVLVNLAKHPDAKDEKYRKALMEAEKEVRINLGKLEALKPRINKRYERY
AQLMRERQVRTSHQETTSSKQVQPYDPALAGVVEPLEAGKNRDLAVQLARTEISRRATVR
KALRQADVPLEEEQSRRTAGVWNNWEVAVDKNGRGMDNDLSRRIQDVRLNIDQQTHANAR
PQQSKPAERSSSTYKYPSVPRTKPLEPLPSASTNVSRDGNSLRLEAPLPPPKERFESSYL
TFTDGASPPPLPDKVSSTPAPAVPEKGQPVADGGNSRPDLNPSSFTFKPSAYLENGTPLR
TMWLPPDLRTHFLAIAAPNTRRNLETCGILCGTLISNALFVSRLLIPEQTATSDTCETVN
ESAIFDYCDSEDLMVLGWIHTHPTQTCFMSSRDLHTHCGYQVMLPESIAIVCAPSKSPDW
GVFRLTDPPGLKTVLNCTQSGLFHPHAEANIYTDALRPGHVYEAKGLEFETVDLRPKEAR
G
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgcatgcacccacacccagcatgggagcgtcaccacctcagagcgtggagaag
atcacacggattgcgcaagactacgagtacaacccccttataccgctacgaaactggttg
aggaccgcgtccacactcctcagagaggctcgaatatacgaacgggaaggccatgacgag
caaacatatctactgttatttcgacatgcgcaactagtacttgtgaacctagcaaagcac
cccgatgctaaggatgaaaagtacagaaaggctctcatggaggccgagaaggaggtccgg
atcaatctcgggaaactagaggcgctgaaaccccggatcaataaacgatatgagcgttac
gcccagttgatgcgcgaacgtcaagttcggacttcgcatcaggaaacaacctcgtcgaag
caggtgcaaccatacgaccccgcgttggcgggagtagtcgaacctttggaggcagggaag
aacagagatttggcagtgcagcttgcgcggacggagattagccggagggcgaccgtcagg
aaagccttgcgtcaggctgatgtgccactagaagaggagcaaagccggcgtacggcgggt
gtctggaacaattgggaagttgctgtggacaaaaatggacgcgggatggacaatgacctg
agccgccggattcaagatgtgagactcaacatcgaccagcaaactcatgcgaacgctcgt
ccgcagcaatcgaaacccgcagagcggtccagtagcacctacaagtatccttccgtccct
cggacaaaaccgctggagcctttgccatctgcgtcgacaaacgtgtcccgtgatggaaac
agcttgcgcttggaagctccattgccaccgccaaaggagcgatttgaatcaagttatctg
acatttactgacggagcgtccccaccaccactgcccgacaaggtctcgtcgaccccagct
ccggctgttccagagaagggacagccggtggcagatggcggaaactcacgtccagacctg
aacccctccagcttcacattcaagccgtcggcatatctagagaacgggacaccgttgcgc
accatgtggctacctcccgatctacgaacgcatttcttggccatagcggctcccaacacg
cgacgcaacctagagacgtgcggcatcctgtgcggaactttgatttcgaacgcactattt
gtctccaggctgcttattccagaacagacggcgacgtcagacacatgtgaaaccgtaaac
gagtctgcgatctttgactactgcgattccgaggatttgatggtgttaggctggattcat
acgcaccccacacagacttgttttatgagttcgagggacctccacacgcattgtggatac
caagtgatgctacctgagagcatcgccatcgtttgtgcgccgagtaaatcccctgactgg
ggtgtgttccgactcactgatcccccggggcttaagacggtcctgaactgcacgcagagt
gggctattccatccccatgcggaagctaatatttacaccgatgcgctacgacccgggcac
gtctatgaagccaaagggttggaattcgagactgtggatcttcgtccaaaggaagcccgg
ggttga

DBGET integrated database retrieval system