KEGG   Neosartorya fischeri: NFIA_071470Help
Entry
NFIA_071470       CDS       T01070                                 

Definition
aldose 1-epimerase, putative
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nfi  Neosartorya fischeri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NFIA_071470
   00052 Galactose metabolism
    NFIA_071470
Enzymes [BR:nfi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NFIA_071470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 328 aa AA seqDB search
MSEESGFAFLPLGAIIQEFRVGGKNIVLGFNTQEQYYKYNSPHFGATIGRVANRIKDAVI
HNLNNRDYILAKNNGPNSLHGGEKGWGKCVFDGPQTVKHDGKDALLFKYLSKDGEEGFPG
TVEVRVWYTASKEDSKTVLTTEYEVEFVGNECEETVVNMTNHSYFNLGNGPTIEGTKAQL
STADYLPVDSTGIPLGNIDKFPLDVSKPFVLGAAEPDIDDVFLMETDPSKVVLDTRSQPL
KLLAQFSHPDTGLHLEVHSTEPAFQFYTGKYIDVPAMDGLPARVARAGFCVEPSRYVNAP
NEPAWRPMVLLKKGQIFGCKTVYKAWKA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaatctggattcgcctttctgcctctcggagccatcatccaggagttccgc
gtcggagggaagaacatcgttcttggcttcaacacccaggagcaatattataaatacaac
tcgcctcactttggcgcaacaataggtcgcgtggccaacagaatcaaggatgccgtcatc
cacaacttgaataatcgggactacatcttggccaaaaacaacgggcccaactcactacat
ggcggggagaaaggctggggcaagtgcgtctttgacggccctcagaccgtgaagcacgat
ggcaaggatgctctgctgttcaagtacctcagcaaggacggcgaggaaggcttccccggc
actgtggaagtgcgagtctggtacaccgccagcaaggaagactccaagacagtcctaact
accgagtatgaagttgagtttgtgggtaacgagtgtgaggagacggttgtcaatatgacc
aaccatagttatttcaacctcggcaacggtcctaccattgaaggcaccaaggcccaattg
tccaccgccgactacctgcccgtcgactccaccggtatcccgcttggcaacatcgacaaa
ttccctctggacgtgtccaagccattcgtgctcggcgcggccgagcccgacattgacgat
gtgttcctgatggagaccgatccctccaaggtcgttttggacacgcgcagtcagcccttg
aagctgctggcgcagttcagtcacccggacacgggcctgcacctcgaggtacacagcacc
gagcccgcgttccagttctacacgggcaaatacatcgacgtgcccgcgatggacgggctg
ccagcgcgcgtggctagagccggcttctgcgtggaacccagccgatatgtcaatgcgccc
aacgagccggcatggcggccgatggtgcttttgaaaaagggacagatcttcggatgcaag
accgtgtacaaggcctggaaggcatga

DBGET integrated database retrieval system