KEGG   Neosartorya fischeri: NFIA_071680Help
Entry
NFIA_071680       CDS       T01070                                 

Definition
ubiquitin carboxyl-terminal hydrolase, family 1 protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MSQRNKRRRVNASSSPASVPSNHTMANSFTAAPCNPANVLERQKWNGFCELESEPAIFNV
MLREFGVKGVKVQEVVSLDDELMAFLNKPVYGLIFLFRWREDDPDKQEASCPEGLWFANQ
VSSNACASVALLNIVNNIEGIELGENLRHFREFTMPFTPALRGDAINNFEFVKRIHNSFA
RRMDILNSDLQLKVEATSKRSRSGKNRHDEFETDAGFHFIAFVPALGKVWKFDGLERQPQ
ALGEYAPDDDWLTLVRPNILTRMAEYEEDQIEFSILSVAKDPLVELEDQLAVNVKCLEAV
NRWLASREEAEETCPGPESPVSLLENTILGPDSSFNLTRHRIDTVIIPPEREVQYAKASA
EELRQHRYWLSNEQRELRASILEEQQSHRADDNYATGRRFDYGPAVRAWIRFLARKRVIE
SLT
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgcaacaaacgcagaagagtgaatgccagttcaagcccagcatctgtgccg
tcgaatcatacgatggcaaactcatttactgcagcgccatgcaatcctgccaatgtgttg
gaaaggcaaaaatggaacggcttctgtgagcttgagtcggagccggctatcttcaatgtg
atgttgcgcgagttcggagtcaaaggggtcaaggttcaagaagttgtctcactggacgat
gaattgatggcatttctaaataaaccagtatatggtctaatctttctgtttcgttggcga
gaagatgatcctgataagcaggaagcgagctgtccagaaggactttggtttgcaaaccag
gtctctagtaatgcctgcgcaagcgtggcactcctgaacattgtaaacaatatcgaagga
attgagcttggggaaaatctacgacatttcagagaatttacgatgccgttcacaccagcg
ttgaggggtgatgccatcaacaactttgaattcgtcaaaaggatacacaactcgtttgca
agaagaatggacatactgaattcagatctacagctgaaggtggaggcgacatccaaacgt
tctcgatcgggcaagaacaggcatgatgagtttgagactgacgctggattccattttatc
gcgtttgtcccggcgctgggcaaagtctggaagtttgacggcttggagcgtcagccccaa
gctctcggggaatatgcgcccgacgatgactggctgaccctagtacggcccaacatcctc
accaggatggcggagtacgaagaggatcaaattgagttctccattctcagcgtggctaag
gatccgcttgttgagctcgaagatcagctggcagtcaatgtcaaatgcttggaagcagtc
aaccgctggttggcttcccgcgaggaggccgaggaaacctgtcccgggcccgaaagtccc
gtgtctctgctcgaaaacacaatactgggccccgacagctcctttaacttaacgaggcat
cgcatcgacactgtgatcatcccaccagagcgtgaagtacaatatgcgaaagcctcagcg
gaggaactgaggcagcatcgatactggctcagcaacgagcagcgggagcttcgagcatct
attttggaagaacagcaatcccaccgggcggacgataactatgcaaccggacggcggttc
gactatggtccagcagtgagagcgtggattcggtttttggcgcgcaaaagagtcatagag
agcttgacttga

DBGET integrated database retrieval system