KEGG   Neosartorya fischeri: NFIA_071800Help
Entry
NFIA_071800       CDS       T01070                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MAWYCSGTTNAELIENLSKEGLIKNDRVKKAMMGVDRAHYAPSRPYSDSPQPIGHGATIS
APHMHGHACEYLVEFLKPGSRVLDIGSGSGYLTHVLANLVTDRSTNDASGQVIGVDHIPE
LVDLARANMSKSEQGRTLLNSGKVKFITADGRLGWREGAPYDAIHVGAAADKLHPVLIEQ
LRAPGRLFIPVDVENDDGTLSSLGLGGGQYIWVVDKKEDGSVHKEKIFQVSYVPLTDAPK
RSA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcttggtactgttccggcaccacaaatgctgagttgatcgagaacctctccaaggaa
ggactgattaaaaatgatcgggtgaaaaaagctatgatgggcgttgatcgcgcccattac
gcgccctcgaggccatactccgactcgccgcaacctatcggacatggagcgacgatctcg
gcgccacatatgcatggccatgcttgcgaatacttagttgagttcctcaagcccggatcc
cgggtattggatatcggctcaggatccggttatttgacgcatgttctcgccaatcttgtt
acagataggtctaccaatgatgccagtggtcaggttatcggagtggaccatatcccggaa
cttgttgacctggcccgggcgaacatgagcaagtcagagcaaggtcgcactctcctaaat
tccggaaaagtgaaattcatcaccgccgatggtcggcttggctggagggaaggggcccct
tacgatgcaatccatgtgggcgcagcggcagacaagttacacccggttctcattgagcag
ttacgtgccccaggacgcttgttcatacccgttgatgtggaaaatgacgatggcacccta
agtagccttggactcggtggtggacagtacatatgggttgttgacaagaaagaggatggc
tctgttcacaaggagaaaattttccaggttagctatgtgccattgacggatgcgccgaag
cgatcagcctaa

DBGET integrated database retrieval system