KEGG   Neosartorya fischeri: NFIA_071820Help
Entry
NFIA_071820       CDS       T01070                                 

Definition
dihydrolipoamide succinyltransferase, putative
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nfi  Neosartorya fischeri
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:nfi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nfi00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:nfi00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 394 aa AA seqDB search
MTFFADLAAADTIVKVPQMAESITEGTLKQFSKQVGDYVERDEEIATIETDKIDVSVNAP
ESGTIKELLVNEEDTVTVGQDLIKLELGGAPGPKEETATEKPKEAADVEKRPPAESNKPQ
PSEAPKAPSPPPEQPPTAKPQAPAPKSETPSDVKPSFEGREERRVKMNRMRLRIAERLKQ
SQNTAASLTTFNEVDMSSLMEFRKLYKDDVLKKTGVKLGFMSAFSRACVLAMKDVPAVNA
SIEGPNGGDTIVYRDYVDISVAVATEKGLVTPVVRNAETMDLVGIEKAIADLGKKARDNK
LTIEDMAGGTFTISNGGVFGSLMGTPIINLPQTAVLGLHAIKDRPAVVNGKVEIRPMMYL
ALTYDHRLLDGREAVTFLVKVKEYIEDPRRMLLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcttcgctgatctcgctgcagctgataccatagtgaaggtccctcagatggca
gaatcgatcaccgagggtacattgaagcaattctcgaagcaggtgggcgattacgttgag
cgggacgaagaaatcgctacaattgagaccgacaagatcgacgtgtcggtcaatgcgcct
gagtctgggactattaaggagctcctcgtgaacgaagaagacactgtgacggttggccag
gacttgatcaaactcgaattaggtggcgctcctgggccaaaagaggagacagctactgag
aagccaaaggaggccgcagatgtcgagaagcggcctcctgctgagtccaacaagccacag
ccgtcagaggcccccaaagctccatcgcctccgcctgaacagcctcctactgccaagcct
caggcccctgctcctaagtcagagactccttctgacgtcaaaccgagcttcgaaggtcgt
gaggaacgcagggtgaaaatgaatagaatgaggctgagaatagccgagcgcctgaagcag
tcccagaacaccgctgcctcgctcactaccttcaacgaagttgacatgtcatccctcatg
gaatttcggaaactctacaaagatgatgtactgaagaaaaccggcgtcaagcttggcttc
atgagcgctttttctcgtgcctgcgtcctagctatgaaagacgtccccgccgttaacgca
tcaatcgaaggccccaatggtggtgataccattgtttaccgcgactacgttgacatcagc
gtggccgttgctactgagaagggccttgtgacacctgtcgtccgtaacgctgaaaccatg
gacctcgtcggaattgaaaaggccatagcagaccttggcaagaaggcgcgggacaacaag
ttgacaatcgaggatatggctggtggcacgttcaccattagcaacggtggtgttttcggc
tctttgatgggcactccgatcatcaacttgccccagactgctgttcttggactccatgca
atcaaggaccggccagcagttgtgaacggtaaagtggaaattcgtccaatgatgtacctt
gccctaacctatgatcatcgactcttggatggacgggaggcagtcactttccttgtcaag
gtcaaggaatacattgaagatcctcgtcggatgttgctcggctag

DBGET integrated database retrieval system