KEGG   Neosartorya fischeri: NFIA_071840Help
Entry
NFIA_071840       CDS       T01070                                 

Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 140 aa AA seqDB search
MPPKAAEKKPSTGGKAPAGKAPAEKKEAGKKTAAAATGDKKKRGKTRKETYSSYIYKVLK
QVHPDTGISTRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGEL
AKHAVSEGTKAVTKYSSSAK
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaaagctgccgagaagaagcctagcactggtggcaaggcgcccgctggaaag
gctcctgctgagaagaaggaagctggcaagaagaccgccgctgctgccactggcgacaag
aagaagcgtggcaagaccaggaaggaaacctattcctcctacatctacaaggttctcaaa
caagttcatcccgacactggtatttcgactcgtgccatgtctatcctgaactcctttgtc
aatgatatctttgagcgcgtcgccacggaggcgtcaaagcttgctgcttacaacaagaaa
tcgaccatctcgtcgagggagatccagacttctgttcggctcatccttcctggtgagttg
gcgaagcacgccgtttcggaaggcactaaggctgtcacgaagtactcttcttctgccaaa
tag

DBGET integrated database retrieval system