KEGG   Aspergillus fischeri: NFIA_072410Help
Entry
NFIA_072410       CDS       T01070                                 

Definition
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00052  Galactose metabolism
nfi00511  Other glycan degradation
nfi00600  Sphingolipid metabolism
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    NFIA_072410
  Lipid metabolism
   00600 Sphingolipid metabolism
    NFIA_072410
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NFIA_072410
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     NFIA_072410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 4586035
NCBI-ProteinID: XP_001259224
UniProt: A1DD70
AA seq 1055 aa AA seqDB search
MTLSAVPDYENQHIFQRNRLKPRAYFLPETSISLNGRWDFNYAASPVSAPEPSWSKGTKN
ATSEPRRDLNQSSSDGADSETAWAPITVPGHWQLQGYGRPHYTNVIYPFPVCPPFVPTEN
PTGTYRRTFHVPAEWDASSQLRLRFDGVDSAYHVWVNGVPIGYSQGSRNPAEFDVSQVVD
RDGANELFVRVYQWSDGSYIEDQDQWWLSGIFRDVTLLAFPGQARIEDFFVRTELDKDYV
DATLRLSLDLALATAAIAQVTLSDPSTDSTLQSEKYFLQAKQDKLEAELSVSNPRKWTAE
TPNLYDLRIALYVDGAKEPVQAINHRVGFRQVEIKNGNITVNGVPVMFRGVNRHDHHPRF
GRAVPLSFLREDLLIMKRHNVNALRCSHYPSHPRLYELCDELGLWVMDEADLECHGFYDA
IARPLDIPESMDYEERKKLTFDQAAQFTTDNPEWKDAYVDRMVQMVQRDKNHSCIIIWSL
GNEAFYGSNHQAMYDYVKQVDPSRPVHYEGDMEAKTVDMYSYMYPSVERLVGVATAEGDE
FKKPIVLCEYAHAMGNAPGGLEEYMEAFRTHRRLQGGWIWEWANHGLWDEEKGWYGYGGD
FGDTPHDGNFVLDGLLFSDHTPTPGITELKKAYAPVRVWPGEDGTLVVANDYNFVGLEGL
QASYKIEVLGDSGRIIATGNIKLPSIPAGQKGTIELPSAPATTTPGEVWLTVNFYEKAET
AWAGSNYEVAWYQQCLKSSSPRPSLAVPAQALTLSSTKTTHKISGATFSLEFSRETGSLY
AWTSDGLSLLDQSSTFGAVSPGFWRPPTDNDMSHDLLEWRRYGLDTLTSQLRRMHVVQHN
PTSVEVTTETYISAPILGWGFFASTSYTIAGNGAVTVNVHLKSHGPIPADLPRLGLDVLL
SDELDNTSWFGLGPGEAYADKKRAQKVGIYNATTAELHTPYEVPQEGGNRMDTRWLRVHD
SRGWGLRVTRVKEESDKQPTELFQWLATRYSPEAIEAAKHAPELVAEKRVRLRLDVESCG
VGTGACGPRTLDKYRVKCEERKFGFTLQPVLAETC
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtccgcagtccccgactacgaaaaccagcacatattccagcgcaatcggctc
aaaccaagagcatatttccttcccgagacgtctatctcgctcaatggtcgctgggacttt
aactatgcagcctctcccgtgagcgccccggagccatcatggtccaagggcaccaagaac
gccacgtccgaaccccgccgggatttaaaccaatccagctctgacggcgcagactccgag
acagcttgggctcctatcaccgttcctggccattggcaattgcaaggttatggccgtcca
cactacacaaacgtcatttaccctttccccgtctgtccgccatttgtgccgacggagaat
cctacgggcacctatcgtcggaccttccacgtgcctgccgagtgggatgcttcgtcccaa
ttgcggctgaggtttgacggcgttgacagcgcgtatcatgtctgggtcaatggtgtcccg
attgggtattctcaagggagccgtaacccggctgaattcgatgtgtcgcaagttgttgac
cgcgacggcgccaatgaactgtttgtcagagtgtatcagtggtctgatggctcgtatatc
gaggaccaggaccaatggtggttgtcaggcatttttcgcgatgtgaccctgctcgcattc
cctggccaggcgcgcattgaagacttcttcgtgcgcaccgaactggacaaggattacgtc
gacgcgacattgcgtttgtcgttggatctagctcttgcaacagcagccatcgcgcaagtg
actttgagcgatccttcgaccgacagtacgctgcagtcggagaagtatttccttcaagca
aagcaggacaagctcgaagctgagctttccgtctccaacccgaggaaatggacagcagag
acacccaacctctacgatctgcgcatcgctctctatgtagacggtgccaaggagcccgtg
caggcaatcaaccaccgtgtcgggttccgtcaggttgagatcaagaatggcaatatcact
gtgaacggcgtgccggtgatgttccgcggcgtcaaccggcacgaccaccatccacgcttc
ggccgagcggttcctctgtccttcctgcgggaggacctcttgatcatgaagcggcataac
gtcaatgctctccgctgctcgcactacccgtcccatccccgtctatacgagctctgcgac
gagctcggcctatgggtaatggacgaggcagacctggagtgtcacggtttttacgatgcc
atcgctcgccccctggatatccccgagtccatggactacgaggagcgcaagaagctcacc
tttgaccaggcggcgcagttcaccacggacaaccccgagtggaaagatgcatatgtagac
cgaatggtacagatggtgcagcgcgataagaaccattcctgtatcatcatctggtcgctc
ggcaatgaggcattttatggctctaaccaccaagccatgtacgactatgtcaagcaggtt
gaccccagtcgtccggtgcactacgagggagacatggaggccaagacggtcgacatgtac
tcgtatatgtatccatcagtcgagcgacttgtcggtgttgctactgcagagggagatgag
tttaaaaagccaattgtgctttgtgagtatgctcacgcgatgggtaacgcgcctggtggc
ttggaagagtatatggaagccttccggacccaccggcgtctgcaaggagggtggatctgg
gagtgggcaaaccacgggctctgggacgaggagaagggatggtatggctacggtggtgac
tttggcgatacgcctcacgatggcaactttgtgctggacgggctgctattcagtgaccac
accccaacgcctggtatcactgaactcaagaaggcgtatgcgccggttcgtgtgtggcct
ggtgaggatgggactctggttgtggcgaacgactacaattttgttgggttggaaggtctc
caggcttcttacaagattgaggtattgggagatagcgggcgcattattgccacaggcaat
ataaaacttccgtctattcctgccggccaaaaagggactatcgagctgccatctgcgcct
gctacaacaactcccggggaggtgtggctcaccgtcaacttctatgaaaaagcagagaca
gcatgggccggaagcaactatgaagtcgcttggtaccagcagtgcctcaagtcctcatct
ccgcgtccctcattggctgtacccgctcaggctttgacgctctcatccacgaagacgaca
cacaaaatctccggcgccacattcagcctggaattctcgagagaaacaggcagtctctac
gcctggacatccgacggcctctccctcctcgaccagtcctcaacatttggtgccgtctct
cccggattctggcgcccaccgaccgacaacgacatgtcccatgatctccttgaatggcgg
cgctatgggctcgacactctcacctctcagctgcgcaggatgcacgtcgtgcaacataac
cccacgagcgtagaagtcactacggagacatacatctccgcgccaattctgggctgggga
ttcttcgcctcgaccagttataccatcgctggcaatggtgccgtaaccgtcaacgtgcac
ctgaagtcccacggtcccatcccagcggacctgccccggctcggcctagacgtacttctc
tcagacgagctagacaacacatcctggttcggcctgggacccggcgaagcctacgcagac
aagaagcgcgcgcaaaaggtgggcatttacaacgctaccacggcggaactgcataccccc
tacgaagtgccacaggaagggggcaaccggatggacacccggtggttacgtgtgcacgac
agcaggggatggggtctccgggtgactcgcgtcaaggaagagagtgataagcagccgact
gagctgttccagtggcttgctacgcggtacagccccgaggctatcgaggcggccaagcat
gcgcctgaactggttgctgagaaacgggtcaggttgaggctggacgtggagagctgcggt
gttggaacgggagcttgtggtcctcgtacccttgacaagtaccgggttaaatgtgaggag
agaaagtttggctttactctgcagcctgttttggccgagacgtgttag

DBGET integrated database retrieval system