KEGG   Neosartorya fischeri: NFIA_073420Help
Entry
NFIA_073420       CDS       T01070                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 581 aa AA seqDB search
MNFQAKSEAMQRILGLNNSSLSSFLPSSTTFSGFGTALLGAKDHLPPGLGNWDNSCYQNS
IIQGLASLHSLAEFLERNIRTLGDKGSFSTHQALRGVIERLNNADNHDQRLWIPAELKSM
SSWQQQDAQEYFSKVVGQVDHEVQQATKRRTRNLGLKMAGPVENIIGAEPHTDVDGADGS
SPRAAERHLTRNPLEGLLAQRVGCMKCGWTEGLSLIPFNCLTVPLGGQHEYDVRQCLDQY
MHLEPIEGVECAKCTLLRAKDQLENLLKQIEEDMKLPDTPDSSKVSGALRTSAEERLRAV
EEALEEDDFAEKTLSKKCRIPSKNRVTSTKSRQAVIARTPKCLVIHINRSMFDENTGMLR
KNYAAVRFPNVLDLNEWCLGTKSSSWGQMDIERWGTDPRESMLPEAGSASDVSGRFFELR
AVVTHYGRHENGHYICYRKYPSDLFPAHVPDTVLEADGEKDKAERWFRLSDDDVQMVSEA
SVMSQGGAFMLFYEAVDRQRSEYTPTQGTHAVEDEKLESVCDLGTSNDMSTTSTIIDGSP
DTSPATSVSAADRFDVPLDKLQLLTDDHASLLGKSSLEVTP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaactttcaagcgaagagcgaagcaatgcaacgtatccttgggctcaataactcctcc
ctctcctccttccttccttcttctacgaccttttcaggattcggtacagcgttactcggc
gccaaggaccatctgcccccggggctcggaaactgggacaattcatgctatcagaatagc
atcattcagggtctagcatctctacactctcttgcagagttcttggagcgcaacatccgg
acattgggggataaaggatccttttcgactcatcaggctctcagaggcgtcatcgagcgg
ttaaacaatgctgataatcatgatcagcggctgtggattccggcggagctcaaatcgatg
agcagttggcaacagcaggatgcgcaggaatacttttcgaaggttgtcggtcaggtcgat
cacgaggtgcagcaggctacgaaacgccggacgaggaatttggggttgaaaatggcaggg
cctgtcgagaacatcatcggggcagaaccacatacggatgtggatggcgcagacggttca
tctcctcgtgcagctgaacggcatctgactcgcaaccctctggagggccttcttgcgcaa
agagtaggttgcatgaaatgcggctggactgaaggtctttccctcattccgttcaactgc
cttacggtgccacttggagggcaacacgaatacgatgtacgacaatgccttgatcagtac
atgcacctcgagcccatcgaaggtgtggaatgtgcaaagtgcacccttctacgcgccaag
gaccagctagaaaatcttcttaaacagatcgaagaagacatgaagctgcctgatacgcct
gactcttcaaaagtctcaggagcactcaggacctccgctgaagagcgattgcgggctgtt
gaggaagcactagaagaggatgattttgcggagaagaccttgtcgaagaagtgccgtatt
ccgtccaagaaccgcgtcacgtcgaccaaatcaagacaggcggtaatcgcgaggacgccg
aaatgccttgtgatacatatcaaccgaagcatgttcgacgagaatacagggatgctcagg
aagaattatgctgccgtcagattccccaatgtccttgacttgaatgaatggtgtctgggg
acaaagtcctccagttggggtcagatggacattgaaagatggggcaccgaccctagggag
tctatgctacctgaagctgggtcagcttccgatgtctccggccgctttttcgagttgcgg
gccgtggttacgcactacggccgccatgaaaatggacattatatctgctacagaaaatac
ccatcagacctcttcccggcccacgtcccagacaccgtgctggaggcggatggcgaaaag
gacaaagctgaacggtggtttcgattgagtgacgacgatgtacaaatggtcagtgaggca
agcgtgatgtctcagggtggtgctttcatgctgttttatgaagccgttgatcggcaacgc
tcagaatatactccgactcagggaacacacgcagtggaggacgagaagctcgagtccgtc
tgcgatttaggaacttcaaacgatatgtctacgacgtctacgatcatcgacggttctcct
gatacgtccccggcgacaagcgtatccgctgcagacagattcgatgtgccccttgacaag
cttcagcttctgactgatgatcatgcaagcttactgggcaaatcttctcttgaggtcacg
ccttaa

DBGET integrated database retrieval system