KEGG   Neosartorya fischeri: NFIA_073850Help
Entry
NFIA_073850       CDS       T01070                                 

Definition
agmatinase, putative
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
nfi  Neosartorya fischeri
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nfi00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 299 aa AA seqDB search
MLTMVVWQGSRKLGFSGGYNVPLEANPFVSELKVLDCGDIPVTSYDNAWAIQQIEEGHNS
LLMRKPFTNADAEGLSRAGKTLPRIITLGGDHTITLPLLRSINKAYGPVTVIHFDSHLDT
WKPKVFGGSPSQVAAINHGTYFYHAAMEGLLKNDTNIHAGIRTTLSGPSDYENDGYCGFE
IVEAREIDTIGTEGIIKKIRDRVGTENPVYLSIDIDTLDPAFAPATGTPETGGWSTRELR
TIIRGLDGLNFIGADIVEVAPAYDTNAELSTMAAADVLYEVLTIMVKKGPLSISKGHEL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgatggtggtttggcaaggctcacgcaaattggggtttagcggtggctacaat
gtaccgctggaagcgaatccgttcgtcagtgagctaaaggttttggattgtggtgatatt
cctgtgacgtcgtacgacaatgcttgggccatccagcagattgaagaaggacataacagc
ttgctgatgcgcaagcctttcaccaatgcggatgctgaaggattgtccagggccggaaag
actctgccgcggattatcacgctgggtggtgatcataccatcacactgccgttgctgcgc
agtatcaacaaggcctacgggcccgtgactgtgatccattttgacagtcatctggacaca
tggaagcccaaggtctttggcggctcgcctagtcaggttgctgctatcaaccacggaacc
tacttctaccacgctgccatggaaggtctcctgaagaacgacaccaacatccatgccggc
atcaggacgaccctttctggtccctctgattatgagaatgacgggtactgcggcttcgag
atcgtcgaggcgcgtgaaattgatactatcggaaccgaaggaatcatcaagaagatcaga
gatcgagtcggcacagagaaccctgtctacctttccattgacatcgatactctggaccct
gcttttgcacctgcaaccggtactcccgagactggaggctggtcgacccgtgaactgcgc
accatcatccgtggccttgatggcctcaacttcatcggtgcggatatcgtcgaggtcgct
ccagcttatgatacaaacgcagagctttctaccatggccgctgcggatgttctttacgag
gttcttaccatcatggttaagaagggaccattgtctatttccaagggacatgagttgtag

DBGET integrated database retrieval system