KEGG   Neosartorya fischeri: NFIA_074540Help
Entry
NFIA_074540       CDS       T01070                                 

Definition
nuclear pore complex subunit Nup192, putative
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
nfi  Neosartorya fischeri
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    NFIA_074540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1668 aa AA seqDB search
MEDGDTLAGLRGLYQDLSALSDSSFVNIERLRVELEAHIEDFKKLLDKPSKNNTSRQAVL
SGKITVDDVEYSINQDFQQGALQLADALNIDELEAAVLFFAAQEEAQILDRPPLIAAIMR
FHERRHFLLECLRLILQESFEVEREVTQALMQDMVAFVVEIKTGPLRNASLFARKCMKSM
EDIEGWLLLLGEQIQKASIVGQVEDRDVMEAIEYQRSSLQQQHESLGAILCYFFKGPYTS
PEDLRVLLNRLRKLERFDGLLLHYIPAMISSFVQHGSPERSNSYKEARSLHMAVTSTKDG
QTWTIPTFHAAVIALWLAVYSGWDIDGPTSPVQGVDFEKEAEERTQMFMTALDDGGLDFL
LAICSGVNNEEWGDPARRELVALLLKESAFAKLESEPCAGFLKTLLMENLEVFVESCIAN
MPDAVRKLKSEEDMQRLDQITALRDGLSSSLHRGLVEARTHLESFLMIIAFAFESRPDAA
QEFWADPDGNLYGFLQWASKRQTVPRVSAFCELLCSISGGEENAAAAHRFLTEEDKFLSS
KFKRSTSMNWSQMFAELQLYATRVTEKPSASQAVLRARKSEPADMSEPESPVMLTCYLRL
MGHLCKQSGSIREWMLQHPSFSIVSTLLTLCSGPIPTHLRATVFTTLAALMTDRTSHNGN
EMWLSLDQWISGGAMSGPGLGKVPIVSNPLVWHEQQAFQKIGESFDQANAFVVLICSLIS
PTSDSAEYHLSLPFPESLGSSYRMPGIEPYIDFVMGQALSRKVPDLGERQTRLLTYNCLN
FVITCLRSFNENIVTVLSQPAVSSDSTLKTSSLTTYIRLHPFARVAEWLFNEDVIKAIFA
TAQQDASEVANAASDSIIVQCLVKSLEVMDLILDLQSTYFHIVRPSIKSQAGGSRINVAN
SSLSSFEDSVLNNLTIIPALSLYCGAGHEQLTVTSMALLEKMSSSGKLNKLSSPEISKWQ
SSNKIVEVLSTEVDVDSVSRPLVSQMQPELRELELGARSPGYIIRESLLALLNSCLSMIT
DRPTIAHLLLGFSSVGTMLDISPNGLFSNRMSLLHAIIGFLQSYPDAMEGNILPWMVHLR
RMAFEVLKHLWSSKIASAFTLFEMRSSRFLLSMFASQPIIGPDTPFDGLSVMDEEFWISE
STSALAEFLLFRSYLYAYAATEIRSAAKLGSQTLQTEVLSTLLGNSTTETGETILNPTVF
DLFDFADLDLSHRIPAPRLIFLDGIGFDVCAKSQADEALVLYNLAEVAELIQVRKEELLS
SGQLRPQDEEQFSAEAEGLTLFIRATNQARQIAFNRYLALRSWTELITTMLACSEIEGGR
KPTFILHSIQLVLPKLEAAIEEDLPEAIELARLAETLIGGFESTSTSTDGARRSGDIIDE
KLHQLFQICIRGIFLASGNVQLRETFYNIGSQYISRIASADTVNQNLRHHSQQVIKTAGS
NLIETTCDDAYAGQEACRVSALLFLNLLASLDRETDSTLAELISQSNYLSLFLDAIRALP
LELKNTQANDTPALLSYYESLLSLLQRLCQTKNGATQVLKTGLFQAVRESRLFAADPDLG
IDIDNPDALRKYYDLLGSVLRVIISAVFSRGLHNEQIMEQTRAFLAENRQSMVGIFKRFA
KIGGVGTADHHGALSDLAKCYMTLISATNFLEYEDEEVKERTRPTLFS
NT seq 5007 nt NT seq  +upstreamnt  +downstreamnt
atggaagacggagataccctggctggccttcggggcctgtatcaggatctttctgctctt
tcagactcgtcatttgtcaacattgaacggcttcgtgttgagttggaagctcacattgag
gatttcaagaaactcttagacaaaccctcaaagaacaacacaagtcggcaggctgttctc
tcagggaagattaccgttgacgatgtcgaatattcaatcaaccaagactttcaacaaggc
gcactacaacttgcggatgctctcaacattgatgaactggaggcagctgttttattcttt
gcggcgcaggaagaagctcaaatactggatagacctccgctgatcgcggcaattatgcgc
tttcatgagcggcggcacttccttcttgaatgcttacgtctgattcttcaagaatcgttt
gaggttgagcgggaagtgacgcaagctctcatgcaagacatggtggcattcgtcgtggag
atcaaaactggacccctacggaatgcatcgctttttgcgcggaagtgcatgaagtctatg
gaggatatcgagggatggctgctgctccttggggagcagattcaaaaggcatccattgtc
ggccaggtggaggatcgcgatgttatggaagccattgaataccaacgcagcagcctgcag
caacaacacgagtcattaggcgcaattctatgctatttcttcaaaggaccttataccagt
cctgaggaccttcgggtgctcctgaatcgcttaaggaagcttgaaagatttgatggactg
ctgcttcactacatccctgctatgatatcgtcgtttgttcagcacggctcaccagaacgt
tcgaattcatacaaagaggctaggagcctgcacatggcggtcacttctaccaaagatggc
caaacttggacgatcccgacgtttcacgcagctgtcatcgcgctttggcttgcagtttac
agtggctgggatatcgatgggccgacctctcctgtccaaggggtcgacttcgaaaaagaa
gcagaggagcgcactcaaatgttcatgacggcactggacgatggaggactcgatttctta
cttgctatttgctcaggtgtgaacaacgaagaatggggtgatccggctcgccgcgaatta
gtggcgctactgttgaaagagagcgcattcgcgaaattggaatccgaaccctgtgctgga
tttctaaagacactactgatggagaatctggaggtctttgtggagtcttgcattgccaac
atgccagatgcagttcgaaagctgaaatccgaggaggatatgcaacgcttggatcagatt
actgccctgagggatggtttgtcgtccagcctccatcgtggcctggtcgaagctcgcact
catctcgagtctttcctcatgatcatagcattcgccttcgaaagccggccagacgcagct
caggagttctgggcagacccggacggcaatttgtatggcttccttcagtgggcttccaag
agacaaaccgttccaagagtgagcgccttttgcgagttgctgtgttctatttctggtgga
gaggagaatgccgctgctgcacatcggtttctaaccgaggaggacaaatttttgtcgtcc
aagttcaagcgatccacttccatgaattggtcccagatgtttgctgaactccaattgtac
gcgacgagagttactgagaagcctagtgcttcccaagcagtcctgagggctcgaaaatct
gaaccagcagacatgagcgagccagaaagccctgtcatgctgacgtgctatctgcgacta
atgggtcatttatgcaagcagagcggctccataagggagtggatgcttcagcacccatct
ttcagcattgttagcaccttgttgaccttgtgcagcggccccatacccacccacctgagg
gccactgttttcactactcttgcagctttaatgacggatagaacgtcccacaatggcaac
gagatgtggctctctctcgatcaatggatttccgggggcgccatgagtggccccggcctt
ggtaaagtacccatagtctcaaatccattggtatggcacgagcagcaggctttccagaag
atcggcgagagttttgatcaggccaatgcctttgtggtcttaatttgctcgcttatttcc
cctacctctgactcggcagagtaccatctgtccctgcccttccccgaatctctaggatcc
tcctatcgcatgccaggtatcgagccgtacatcgattttgtcatgggtcaggccctctcg
aggaaagttccagatctaggcgagcgccaaactcgccttctgacctacaactgcttgaat
ttcgtcatcacgtgcctgagatcgttcaacgagaatatcgtaactgttctcagccaaccc
gcagtcagctccgattctaccctaaaaacatcatccttgactacctatatccgtcttcac
ccgtttgcgcgtgtggctgagtggctatttaatgaagacgttatcaaggcgatcttcgca
acagctcaacaagacgccagcgaggttgccaacgccgcgtctgactctataattgttcag
tgcctggtcaaaagcctcgaagtcatggacctgatattggatctgcaatcgacctacttc
catatcgtccggccgtccatcaagtctcaggcaggtggaagcagaattaacgtcgctaat
tcgtcgctttcatccttcgaggatagcgtcctcaacaacttaacgatcatacctgctctg
agcctttattgcggcgcgggtcacgagcaactcaccgttacctcaatggcacttctggag
aaaatgtcaagctctgggaagttgaacaagttgtcctcaccagaaatatcgaagtggcaa
tcctcaaacaaaatagtcgaagttctgagcacagaagtggacgttgacagtgtttcacga
ccgctggtgtctcagatgcaacctgaattgagggagttggaacttggtgcacggtcccca
ggctatattattagggaaagccttttggcactcctaaatagctgtctcagcatgatcacg
gatcggccgaccattgctcatcttctcctcgggttcagtagcgtgggaaccatgctggat
atttctccgaacggtctgttctcgaaccgaatgtccttgctacatgctatcattgggttc
ttgcaaagctaccccgatgcgatggaagggaacattcttccttggatggtacatctacgg
cgtatggcctttgaagttctcaaacatctatggtcctccaagatcgcgtccgcgttcact
ctgtttgagatgcgttccagccgctttctactaagcatgtttgccagccagcctataatc
ggaccagacactccttttgatgggttatctgtcatggacgaagaattctggatctctgag
tccacatcagctcttgctgagttcttactttttagaagttacttgtatgcctacgcggcg
accgaaatccgctcggccgccaagcttggctcgcagacacttcagacagaggtcctttca
acgttgcttgggaactcaaccacggagaccggggagacaatcctcaatcccacagtcttt
gatctctttgattttgctgacctggatctcagccacagaattccagcgcccagattaatc
ttccttgatggaattggctttgatgtgtgtgcgaaatcgcaagcagacgaggcgcttgtt
ctgtacaatctagcggaggtcgcagagctcatccaagtcagaaaggaagagttgctgtcg
agtgggcagttgcgacctcaggatgaagagcaattctcggccgaagctgaaggcctaaca
ttattcattcgtgcgacaaatcaagcaaggcaaattgcgtttaaccgttacctggcgctt
cgatcatggacagagctcatcacaacgatgctggcttgttcagagattgagggtggccga
aaaccaacgtttatcttgcattcaatccagttggtcctccctaaacttgaagcagccatc
gaggaggacctaccggaggcaatcgagcttgcacgactcgccgagactcttatcgggggg
ttcgaatctacgtccacgagtacagacggtgcacggcgaagtggggatatcatagacgaa
aaactgcaccagctgttccagatctgcattagaggcattttcctggcaagtggaaatgtt
cagttgcgtgagacattttacaacattggttcccagtacatcagtcgtatcgcctccgcc
gatacagtgaatcagaatctgaggcaccacagtcagcaagtgataaagacagcgggctcg
aacctgattgagactacctgtgacgacgcatacgccgggcaagaagcatgccgggtgtcg
gctctgctcttcctcaatctgctggcctctctggatcgagaaacagactcaactctggcg
gagttgatctcacaatcgaactatctcagtcttttcttggacgccatcagagcgctacct
ctcgaactgaagaacactcaagcaaatgatacgccagcattgttgtcatattacgagtcg
ctgctatctttacttcaacggctctgccaaaccaagaatggcgctactcaagttctgaaa
acaggcctctttcaggcggttcgcgagtcaaggctatttgctgctgatccggatctgggc
attgatattgacaaccctgatgctcttcggaaatattatgatcttcttggctcggtactc
cgagttattatctcagctgtcttctctcggggtcttcataatgagcaaatcatggagcaa
acgcgagctttcctggcagaaaacagacagagcatggtcggcatcttcaagcgatttgcc
aagatcggtggagtaggtactgctgatcatcacggcgcgctgagtgatttggccaagtgc
tacatgacgctcatcagtgccaccaacttcctagagtacgaggacgaggaagtgaaggag
cgaactcgcccgacattattctcctag

  All links  
No link information was found.   
DBGET integrated database retrieval system