KEGG   Neosartorya fischeri: NFIA_075980Help
Entry
NFIA_075980       CDS       T01070                                 

Definition
D-amino acid oxidase
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
nfi  Neosartorya fischeri
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nfi00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nfi00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:nfi00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:nfi00311]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:nfi04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 328 aa AA seqDB search
MPGDYDIEYCSPWAGANYLPVGKSGSPHERWERETWPALKELTEKHPEAGIHFQDTIVYN
RVKDQGSPTGQWFSELVQPNPWYKDVVPDFKGIPADQLAPGIDNAQKFTSVCINTAVYLP
WLVGQCRKNGVVFKRAVFKHVTEAASAHHSGKKADVVVNCTGLSSRKLGGVCDEKLYPAR
GQIVVVRNDPGAMFSISGSDDGEDELVYMMTRAAGGGTIIGGSYQKNQWDPLPDPNLAVR
IMKRAVALCPQLVKEGQGIEGLDIIRHGVGLRPLREGGTRIEAEKIDGVAVVHNYGHGGF
GYQASYGCAAEAVRLVDDVLQRKSKAKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcctggagactacgatatcgaatactgttctccatgggctggagccaactatctccct
gtgggaaaatccgggagtcctcatgagaggtgggaacgagagacatggccagctttgaag
gagctgacagagaaacacccagaggctgggatccattttcaagacacgattgtatacaac
cgagtcaaggaccaaggatcgcctactggccaatggttctccgagctagtgcagcctaat
ccgtggtacaaagatgtcgttcctgactttaaaggcattccggccgaccagctagcccct
ggtattgataacgcgcagaaattcacctcagtctgtatcaacaccgccgtctacctcccc
tggcttgttgggcaatgccgaaagaacggggtggtattcaaaagagccgtcttcaagcac
gttacggaagctgcaagcgcccaccactccggcaagaaggccgacgtggtggtgaattgc
accggtctctcgtctagaaaactgggcggagtatgtgatgagaagctatatccggctcgc
ggccagatcgtcgtcgtccgcaacgatcctggagccatgttttctatctccgggtccgac
gatggtgaagacgagctggtctacatgatgactcgagccgctggcggtggaactatcatc
ggcggctcatatcagaagaaccagtgggatccattgcctgaccctaacctagcagttcgg
attatgaagcgcgcagttgctttgtgcccgcagcttgttaaagagggtcagggcattgaa
ggactggacattatccggcacggggtcggactgcggcctctcagagaaggcggcactcgt
attgaagcggagaagatcgacggggtagcagtcgtgcataactatggccatggaggattt
ggatatcaagcttcatacggttgcgccgcggaggcggttagattggttgatgacgtcttg
cagcgcaagagtaaagcgaagttgtga

DBGET integrated database retrieval system