KEGG   Neosartorya fischeri: NFIA_078710Help
Entry
NFIA_078710       CDS       T01070                                 

Definition
cAMP-dependent protein kinase catalytic subunit, putative
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
nfi  Neosartorya fischeri
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    NFIA_078710
Enzymes [BR:nfi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     NFIA_078710
Protein kinases [BR:nfi01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   NFIA_078710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 396 aa AA seqDB search
MATGKAEPSTHSEIQSSSPSSRGVDTPLENVHEREKQMVTSFRPPHQRSVNPFVIKDRPE
EKQLGISTRSLCVNDFTLIKTLGTGTFARVWLAKFKDEAIRRDNVYALKVLRKADVIKLK
QVEHVRNERKALAAVAGHPFITTLIATFSDEQSLYMLLDYCPGGEIFSYLRRARRFNENT
SKFYAAEITLTIEYLHDVEGVVYRDLKPENILLDADGHIKLVDFGFAKQINDRETYTLCG
TPEYLAPEVIHNSGHGLAVDWWALGILIYEFLVGQPPFWDQNPMRIYEQIVEGRLRFPPN
MSPAAQNIISCLCKTNPSERLGHISGGSARVKAHPFFEDINWDDLFHRRMKGPIIPRVDH
PADTGNFEDYPDVDVRGQAIYTDDMKKKYEALFSDF
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctacaggaaaggccgagccttcgacacatagtgagattcagagctcctctccgtca
tccagaggggtcgacactcctttggaaaacgttcatgaaagagaaaagcagatggttacg
tccttccgaccccctcatcagagatcggtgaatccttttgtcattaaagatcggccggag
gaaaagcagctgggaatatcaactcggagcctttgcgttaatgattttacgctaatcaaa
acacttggtactggtacctttgctcgagtgtggctggcgaaattcaaagacgaagcgatc
cggcgggacaatgtgtacgcgctaaaggttttacgcaaagcagatgtgatcaagttgaag
caagtggagcatgtgcgcaatgagcgaaaagcacttgctgcggttgccggtcaccctttt
atcacgactctgatcgcgacattttccgatgaacagagcctatatatgctgctggactac
tgccccggaggcgagatcttcagctatcttcggcgtgcgcggcgattcaacgagaatacc
tcgaaattctatgcagccgagatcacgctaacgatcgagtaccttcatgacgttgagggc
gtcgtttaccgtgatctgaagccagaaaacatactcttggacgctgacgggcatattaag
ctggtcgactttggattcgcgaagcagatcaacgatcgcgagacatacacgctatgcggc
actccggagtacctggctcctgaggtcatccacaacagcggtcatggcctcgctgtggac
tggtgggctctcgggatcctcatctacgagtttttggttgggcagcccccgttctgggat
cagaacccgatgcgcatctacgaacagatcgtcgagggccgcttgcgttttcctccgaac
atgtcgcccgcagcccagaacatcatatcatgtctctgcaagaccaatccgagtgagcgg
cttggacacatatcaggtggctctgcgagagtcaaagcgcaccctttctttgaggacatc
aattgggatgacttgttccaccggcgcatgaaagggcccatcatcccgcgagttgaccat
cccgcagataccggaaactttgaggactatcccgacgtagacgtgaggggtcaggccatt
tacaccgacgacatgaagaagaaatacgaagctttgttcagcgatttctaa

DBGET integrated database retrieval system