KEGG   Neosartorya fischeri: NFIA_080230Help
Entry
NFIA_080230       CDS       T01070                                 

Definition
cyclin Ccl1, putative
Orthology
K06634  
cyclin H
Organism
nfi  Neosartorya fischeri
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    NFIA_080230
  Replication and repair
   03420 Nucleotide excision repair
    NFIA_080230
Transcription machinery [BR:nfi03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     NFIA_080230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 434 aa AA seqDB search
MFEDDIYRTSSQYKFWSFTEASLRSLRENTNAVASQRVRAALRRAREARQSANSSAAGTP
TAGTTADGKGADEKDIDCLTPEEEKELVRFYCEKAVELADTYKPPLPTTVRATAIQYIRR
FYLSNSPMTYSPKTIMPCALFLATKTDNFYMSLRQFAEKVPGDTTAEDIIAPEFLIMQSL
RFTFDVRHPFRGLEGGVMELQAMAEGLGQPAPHLPHQTSEDLRRGLLAVPPAPNAPQSSS
ITDRIARAHTTTRELLKTAAQMTDAYFLYTPSQIWLAAFMLADRPLAEYYLDTKLGGPAA
ESANAQAGNPLYELRVKLLRTLNQCAALLQSYKPLNSDPEQMKNLKRIGKKFYYCQNPEK
ISLAGQKRIPAAASAAAAASAGEGATSESEVERQAKKRKLERAQRDREARDIFGGELVAQ
RVKEGQVGEQQHPS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaggacgatatctatcggacctcatctcaatataaattttggtctttcacagag
gcctccttacgatcattaagggagaacacaaatgctgtcgctagccaacgagtccgagcg
gctctgcggagagcacgggaggcgcgacagtcagccaactcgtcggctgcggggactcct
acagcagggactactgcagatggcaagggagcggacgagaaggacattgactgtttgaca
ccagaagaagagaaggagttagtgaggttttattgtgaaaaggccgtggagctggcggac
acatataagccacccttgccgacaacagtgcgggccactgcgattcagtacatccgtcga
ttctacctcagcaactcgccaatgacctactctcccaagacaatcatgccctgcgctctc
ttccttgcaaccaagacggacaatttctacatgtccttgcgccagttcgccgaaaaggtc
ccaggcgacacaacggcagaagacatcatcgcccccgagttcctcatcatgcaaagcctc
cgcttcaccttcgacgtccgccaccccttccgcggcctcgaaggcggcgtcatggaactc
caagccatggccgaaggcctgggccaacccgcacctcacctccctcaccagacatcagaa
gacctacgccgcggactcctcgccgtcccgcccgcaccaaacgctccccagtcctcctca
atcacagaccgcatcgcccgcgcacacaccaccacccgcgaactcctcaaaaccgccgcc
caaatgaccgacgcctacttcctctacacaccctcacagatctggctggcagccttcatg
ctcgccgatcgccccctggccgaatactacctcgacacgaaactcggcgggccagccgct
gagagcgccaacgcacaagcagggaacccgctctacgagctccgcgtgaaactcctccgc
acactcaaccagtgcgctgccctcctgcaatcatacaagcccctcaactccgaccccgag
caaatgaagaacctcaaacgcatcgggaagaagttctactactgccagaacccggagaag
atctccctggccggacagaagcggatccctgctgctgcttctgccgctgccgccgcgtcg
gcaggcgaaggcgccacatcggaaagtgaagtcgagaggcaggcgaagaagcggaagctg
gagcgggcgcagagggatcgggaggcgagggatatctttggcggggagctggtggcgcaa
cgggtcaaggagggccaggttggcgagcagcagcatccgtcgtaa

DBGET integrated database retrieval system