KEGG   Neosartorya fischeri: NFIA_080610Help
Entry
NFIA_080610       CDS       T01070                                 

Definition
histone deacetylase HosA
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     NFIA_080610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 487 aa AA seqDB search
MARSAIVQEYNPPPTSNPTLSVDQKVSLERQTNGIPRPQGYRVSWHANPAVEPHHFGQSH
PMKPWRLTLTKQLVMAYGMHHAMDLYLARAATYEEMAEFHQTDYLDFLRQVMPGDMENPE
QSENIARFNFGDDCPIFNGLYNYCSLYAGGSIDAARKLCNNQSEIAVNWSGGLHHAKKAE
ASGFCYVNDIVLGILQLLRHHPRVMYIDIDVHHGDGVEQAFWSTDRVLTVSFHKYDKDNF
FPGTGPLDSTGPTHPLNPGAHHAVNVPLNDGIDDESYIQLFRDIVGACVDTYRPGAIVLQ
CGADSLGCDRLGCFNLNVGAHGACVAFVKTFGLPLLVVGGGGYTPRNVSRAWAHETSILI
DAQDLIDPNIPDTVAFRNHFGPDFSLFPPLSEMRKLENKNSRPYLAGLVQAVREQLRYIQ
GAPSVQMSFIPPDILGLREDTEKEIEEATAQLEEEREEREGPGSAAVKSNRRRELERGAG
YRGELYS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgttccgccattgtccaagaatataatcctccgcctacgtcgaatcccaccctg
agcgttgatcaaaaagtctccctcgagcgccagacgaatggcatccctcgtcctcaaggc
taccgagtctcatggcacgccaatccggccgtggaaccgcaccactttggccagtcgcat
cccatgaagccctggcgactcaccctcacgaagcagctcgtcatggcctacgggatgcac
cacgccatggacctctatctggcccgcgctgcgacgtacgaggagatggctgagttccac
cagacggattacctcgattttttgaggcaagtgatgcccggggacatggagaatccagag
caaagcgaaaacattgcgcggttcaatttcggcgacgactgtcccatcttcaacgggctg
tacaactactgctcgctctacgccggcggtagcattgacgcggcgcgcaaactgtgcaac
aaccagtccgagatcgcggtgaactggtcgggcggcctgcaccacgccaagaaggctgaa
gccagcggcttctgctatgtcaacgacatcgtcctcggcatcttgcagctactccgccac
cacccacgcgtcatgtacatcgacatcgacgtgcaccacggcgacggtgtcgagcaggcc
ttctggtccaccgaccgcgtcctcaccgtctccttccacaaatacgacaaggacaacttc
ttccccggcacggggcccctcgatagcaccggcccaacccacccgctcaaccccggcgcg
caccacgccgtcaacgtccccctcaacgacggcatcgacgacgaatcctacatccagctc
ttccgcgacatcgtcggcgcctgcgtagacacctaccgccccggcgccatcgtcctccaa
tgcggcgccgactccctcggctgcgaccgcctcggttgcttcaacctcaacgtcggcgcc
cacggcgcctgcgtcgccttcgtcaagaccttcggcctgcctctcctcgtcgtcggcggc
ggcggctacaccccgcgcaacgtctcccgcgcctgggcccacgaaacctccatcctcatc
gatgcccaggaccttattgaccccaacatccccgacaccgtcgccttccgcaaccacttc
ggcccggacttctcgctcttcccccctctgtcggaaatgcgcaagctcgagaacaagaac
tcccgcccgtacctcgccggtctcgtccaggccgtccgtgagcagctccgctatatccag
ggggcccccagtgtccagatgagcttcatccccccggatatcctgggtctgcgcgaggac
acggagaaggagatcgaggaggcgacggctcagctggaggaggagcgcgaggagcgcgag
gggcccggtagtgcggcggtcaagagcaatcgacggcgggaattggagaggggtgcggga
taccggggggagctctattcttga

DBGET integrated database retrieval system