KEGG   Neosartorya fischeri: NFIA_082250Help
Entry
NFIA_082250       CDS       T01070                                 

Definition
histone acetyltransferase (Esa1), putative
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 510 aa AA seqDB search
MGVRDSHGEATGTPDPVEKGFATLTTIRIGVKAMVHKDGELRKAEILSIRQRKDGPSFYV
HYVDFNKRLDEWIDASRLDLSHEVEWPQPEKPEKKKTGAGNKAPSKNAQKRARADSRDVS
ATPDLLTGKNVNVGKAQRPSKAGGKENRDGTPLNMPIVTAESISTDGTPKAESDDVEMVD
VSFTDGKSIKEEERALGLMSREEEIERLRTSGSMTQNPTEIHRVRNLNRLQMGKYDIEPW
YFSPYPASFSDVDIIYIDEFCLSYFDDKRAFERHRTKCTLVHPPGNEIYRDDYISFFEVD
GRRQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMCTRDETGCHLVGYFSKEKDSAEGY
NLACILTLPQYQRRGFGRLLISFSYELSKREGKLGSPEKPLSDLGLLGYRQYWRETLVEI
LMEPGRETVSENELALLTSMTEKDVHETLVVLNMLRYYKGNWVIVLTDYVVEQHKKRLEK
EKLKGARKIDPARLQWKPPVFTASSRTWNW
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggagttcgggattctcatggggaggccactgggacgcctgaccctgtcgagaagggc
tttgccaccctcaccaccatccggatcggtgttaaggcgatggtacacaaggatggcgag
ctgagaaaagcagaaattctgtcgatcaggcagcgtaaagatggtcctagcttctatgtt
cactatgtcgatttcaacaaacgtctagatgaatggattgatgcttctcgactggacctg
tctcatgaagttgagtggcctcagccggagaaaccagagaagaagaagaccggtgctggt
aacaaagcgccgagcaaaaatgcgcagaagcgtgcgagagccgatagtcgtgatgtctct
gcaactccagatcttctcacaggcaagaatgtgaacgttggcaaggcacaacgtccgtcc
aaggcaggtggcaaagagaaccgtgacggaactcctctcaatatgcccatcgtcactgcc
gagtccatctcaacggacggaacccctaaggcggagtctgacgatgtcgaaatggttgac
gtcagcttcacggacggcaaaagcatcaaagaagaggagagagcgttaggactcatgtcg
cgcgaagaagagatcgaacgactgcgaacgagcggtagtatgacacagaacccaacggaa
atccatcgtgttcgtaatttgaatcgtcttcaaatgggcaaatatgatattgagccctgg
tacttctcgccttatcccgcttctttctcagacgtcgatatcatctatatcgacgagttc
tgtctgagctatttcgacgacaaacgtgcctttgaacgccaccgtaccaagtgcacgctt
gtccatcctcctggcaacgagatataccgcgatgactacatctcctttttcgaagttgat
ggccgccgtcagcggacgtggtgtcgtaacctttgtctactgagcaaactcttccttgat
cacaaaaccctatactacgatgtcgaccctttcctcttctactgtatgtgcacgagagac
gagacaggctgccatcttgtgggctacttctccaaggagaaggactctgcggaaggctac
aatctggcttgtatcttaacactacctcagtaccaacggcgtgggttcggtcggctgctt
atctccttcagctatgagctcagcaagcgcgagggaaagctcggctctcctgaaaagccg
ctcagtgaccttggtctactgggttaccgtcaatactggcgagaaacgctcgtcgaaata
ctcatggaacctggacgagaaacagtcagtgagaatgagctcgccctattgacttcgatg
actgagaaagacgtccatgagaccctggtcgtcctgaacatgctgcggtactataaagga
aactgggttatcgttctcaccgactacgtggtcgaacagcacaagaagcgtcttgaaaaa
gagaaactcaagggagctcgcaagatcgacccagcacgtcttcagtggaaacctcccgtg
ttcaccgcttcaagccggacatggaactggtga

DBGET integrated database retrieval system