KEGG   Neosartorya fischeri: NFIA_082940Help
Entry
NFIA_082940       CDS       T01070                                 

Definition
protein disulfide isomerase Pdi1, putative
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
nfi  Neosartorya fischeri
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:nfi04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 518 aa AA seqDB search
MRSFAPLVLSLLGASAVASAADATADTTSDVVSLTKDSFKDFMKEHDLVLAEFYAPWCGH
CKALAPKYEEAATELKGKNIPLVKVDCTEEEDLCKENGVEGYPTLKIFRGPDSSKPYQGA
RQADSIVSYMIKQSLPAVSTVTEENLEEIKTMDKIVVIGYFASDDKAANDVFTSFAESQR
DNYLFAATSDSAIAKAEGVKQPSIVLYKDFDEKKAIYDGTIEQEAIFSWVKTASTPLVGE
IGPETYSSYITAGIPLAYIFAETKEERDQYAEEFKPIAEKHKGAINIATIDAKMFGAHAG
NLNLDPQTFPAFAIQDPEKNAKYPYDQSKEINAKEIGKFIQDVLDGKVEPSIKSEPIPET
QEGPVTVVVAHSYQDLVINNDKDVLLEFYAPWCGHCKALAPKYEELAALYAGDFKDKVTI
AKIDATANDVPDSITGFPTIKLYPAGAKDSPVEYSGSRTVEDLANFIKENGKFKVDALEA
ASDKVEEGADVTASPSATSTEAEAPAATGDEKGDHDEL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcttttgctcccttggttttaagccttctcggggctagcgcggtagcctctgct
gctgacgcgacagctgataccacttccgatgtcgtctctctgaccaaagactcgttcaag
gattttatgaaagagcatgacttggttctggccgagttctatgcgccctggtgcggccac
tgcaaggctctagctcccaaatatgaagaggctgctactgagctcaagggaaaaaatatc
cccttggtcaaggtcgattgcactgaggaagaggacttgtgcaaagaaaacggcgtcgag
ggctatcctactctcaagatcttccgcggtcctgattccagtaagccctaccagggagct
cgacaggctgactcgattgtctcatacatgatcaagcagtccctccccgctgtctcaact
gtcactgaagagaacctcgaggagatcaagaccatggacaagattgttgtcatcggttac
tttgcctccgacgacaaggctgccaatgatgtgttcacctcttttgctgaatctcagaga
gacaactacctctttgccgcgaccagcgactcagctattgccaaagcggagggtgtcaag
caaccctcaatcgtgctctacaaggactttgacgagaagaaggctatctacgatggaacg
atcgagcaggaagcgatcttcagctgggtgaaaactgccagcacccctcttgtgggtgag
attggccccgagacctactctagctatattacggccggtatccctctcgcgtacatcttc
gctgagaccaaggaagagcgtgatcagtatgccgaggaattcaagcccattgctgagaag
cacaaaggagccatcaacatcgccacaattgatgccaagatgttcggtgcccacgccgga
aacctcaaccttgaccctcagacattccccgctttcgctatccaggatccggagaagaac
gccaagtacccttacgaccagtccaaggaaatcaatgccaaagaaatcgggaagttcatc
caagatgttcttgatggcaaggttgagcccagcatcaagtctgagcctattcctgaaact
caagaaggacccgtcacagtcgtggtggctcactcctaccaggatcttgtcatcaataac
gacaaggatgttctcctcgaattctacgccccgtggtgtggacactgtaaagctctggcc
cccaagtatgaggagttagcggctctctatgctggcgatttcaaagataaggtcaccatt
gccaagatcgatgctactgccaacgacgttcctgattccatcaccggattccctaccatc
aaactctatcccgccggtgctaaggattctcccgttgagtattctggctctcgtaccgtt
gaggatctggcgaacttcatcaaggagaacggcaagttcaaggtcgacgctcttgaggct
gcctcagacaaggttgaagaaggggctgatgttaccgcttccccttcggctacatccacc
gaggctgaagctcctgctgctactggcgatgagaagggcgaccatgatgaattgtaa

DBGET integrated database retrieval system