KEGG   Neosartorya fischeri: NFIA_083110Help
Entry
NFIA_083110       CDS       T01070                                 

Definition
ubiquitin C-terminal hydrolase, putative
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     NFIA_083110
Peptidases [BR:nfi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   NFIA_083110
Exosome [BR:nfi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NFIA_083110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 732 aa AA seqDB search
MLHYKRFCHPLALNIKRSRKKIQRGEPPQKISKLAIAAETDEDRYDTAIRVICYECRLDD
IDASSGSLAVVVDGVMKAMTFSKKEEIKAWEQEFVPCEHTLCLVQQTPKQTESQELSQCT
MCTLKENLWLCLECGNLGCGRSQFGGLGGNSHALAHSDSTSHAVAVKLGSITADGSADIY
CYKCNEERTDPDLAAHLAHWGINLSAREKTEKSLMEMQVEHNMKWEFSTTSADGHELTPL
FGPGFTGLTNLGNSCYLSSVVQCLFSSPEFQQRYYHSSEEPPLSQQPAEDFETQMRKLAD
GILSGRYSKPNADVIASPDSPEVPHQKGLSPAMFKHLIGRGHEEFSTMRQQDAFEFLLHL
FKLIQRTQCPEGRGNPIDNFRFAVEQRLQCLSCKGVRYRIDEQDNVSIPVPVRRQLGTNS
TDPSADSEFESVTLSECLDVFTANEIVELSCPSCGSSNGFSKRSSFRTMPQELVLNARRF
EVVNWVPRKLDIPVDVSDDPLDFSPYVGSMKEEGEKLLPEDDPSDSGFSPDQNILNQLLA
MGFPRIRCEKALHATGNSDTEAAMNWLFSHMDDPDIDMPLVGSKVTDPANMALQDPSKVG
QLSEMGIDEDRAKRALAATGGDVDRALDWVFSHPDEMPEYESGNRDSGSRLPGNGKIPGF
HETPARYQLRAIVCHKGTSVHAGHYVAFVRKMLPGQDNPSWVMFNDEKVVGVDDIQDMKK
FAYLYFFSRVEA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattacaagcgcttttgccatcctttagcactgaacatcaagaggtcgcgaaag
aagatacagcgtggcgaaccaccacagaaaatttcaaagctcgcgattgctgcagagacg
gatgaagatcgctacgacacagcaatacgagtaatctgttatgagtgccgcttggatgac
atcgatgcatccagtggcagccttgcagtcgtggtagatggggtaatgaaggccatgacc
ttctctaagaaagaagagattaaagcctgggagcaagagtttgtcccatgcgagcatacg
ctttgcttagtgcaacaaacccctaagcagactgagtctcaagagctgagtcagtgcacg
atgtgtactttaaaagagaacctttggctttgtttggaatgtggtaacctgggttgcgga
cgcagtcagttcgggggattgggaggaaattcacatgcgcttgcgcattctgactcaact
tcacatgcggtcgccgtcaagcttggctcaataactgctgatgggagcgcggatatatac
tgttacaagtgcaatgaggaaaggacagacccggacctcgctgctcaccttgctcattgg
ggaatcaatctgagcgcgcgcgaaaaaacagagaaaagcctcatggaaatgcaggttgaa
cacaatatgaaatgggagttctcaaccacatctgcggatggtcacgagctcaccccgtta
ttcgggcctgggtttacaggtttgaccaatctaggaaatagctgttatctttcgagcgtg
gtacagtgcctcttctcctcgccagagttccaacaaagatattatcatagcagcgaagag
ccacctttatctcaacaacccgctgaggacttcgagacgcagatgagaaagctcgctgat
ggcattctttctgggcgttactcaaagcccaatgcagacgtgattgcctcgcctgactct
cctgaggtgccccatcaaaaagggctatcgccagcaatgttcaaacatcttatcggtcgt
ggtcatgaagagttctcaaccatgagacaacaagatgcgtttgaattcttacttcatctg
ttcaagctgattcaacgtacccaatgccccgagggcagaggcaatcctattgataatttt
cgattcgctgtcgagcagcgtctacagtgtctgtcttgcaaaggagtccgttacagaata
gatgagcaagacaacgtctctattcctgttcccgtgcgtcgacagctgggcactaatagc
acagacccctctgcggattcggagttcgaatcagtgactctctctgaatgtctcgatgtt
ttcactgctaatgaaatcgttgagctcagctgtccctcctgtggaagcagcaatgggttc
tcgaagcgttcgtcgtttaggacaatgccgcaggaactagtgctaaacgcccgacgattc
gaagtcgttaattgggttccgaggaaattggatatcccagtggatgtcagcgacgaccca
ctagatttcagcccatatgttggctccatgaaggaggaaggcgaaaagctcctaccagaa
gacgatccatccgatagtgggttctcgcctgatcagaacatcttaaaccagcttcttgcc
atgggctttcccagaattaggtgtgaaaaggcgctacatgcgaccggcaattcagatacc
gaagctgccatgaactggttgttctctcatatggatgacccagatattgatatgccgctt
gtgggcagcaaggttactgaccccgctaacatggccctacaggatccgtcgaaagtaggt
caactgagtgaaatgggtattgatgaggatcgagccaaaagagcgctcgctgcgacaggg
ggcgatgtggatcgagctctcgattgggtattcagtcatcccgacgagatgcctgaatat
gaaagtggaaatcgtgactctggttctcggcttcccggcaatggtaaaattcctggcttt
cacgaaacgccggctagataccaacttcgggctattgtttgccacaaaggtacatcagta
cacgctggacattatgttgcatttgtgcggaagatgctgccgggccaggataatccttcc
tgggttatgtttaatgatgagaaagtcgtgggagtcgatgatattcaggatatgaaaaag
tttgcctatctatacttcttctctcgagtcgaagcttga

  All links  
No link information was found.   
DBGET integrated database retrieval system