KEGG   Neosartorya fischeri: NFIA_083310Help
Entry
NFIA_083310       CDS       T01070                                 

Definition
glutamate 5-kinase, putative
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nfi  Neosartorya fischeri
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nfi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:nfi00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MDVDERPKYLPRIQALAAVGQCRLMSLWDGLFSHLRLPVAQILLTRNDIADRTQYINAQN
TFAQLFDMGVIPIVNENDTLAVSEIKFGDNDTLSAITAAMVKADYLFLMTDVDCLYTSNP
RHNPDAKPIEVVSDISSLEADVSSAGSSLGTGGMSTKIVAAKLATSAGVTTVITKSSKPG
NVLEIVKYLQQTQRGIPWQSSTVETTLSESQSPLSPPLHTRFLPSDTPIQSRSFWLLHGL
KPHGSLYIDHGAYSALLNKASLLPAGVVGVDGHFGQQEAVRLVVVERLSPDSLNGDFLHH
GQEPKEVGRALVNYGSAEIARIKGHRSTHIQSLLGYADSEYVALRENISFFRSDDSARQ
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggatgtggacgagagacccaaatatcttcctcgcatacaggcgctagcagctgtcgga
caatgcagactcatgagcctgtgggacggtttattttcacaccttcgactccctgtagcg
cagatcctcttaaccaggaatgacattgcggataggacacaatacatcaatgctcaaaac
acttttgcccagctgttcgatatgggggtcattcccatcgttaacgagaacgatacactg
gcggtttctgaaattaaattcggtgataatgacactttatcggccataacggcggccatg
gtgaaggccgactacctctttctgatgacagatgttgactgcctatatacctcgaaccct
cgtcacaacccggatgctaagcccatcgaggtggtttccgacatctcctctctggaagcc
gacgtgtcgtctgctggttcatcactcggaactggcggaatgagcacaaagattgtagct
gcaaaattagcaaccagtgctggagtgacgacggtgatcaccaagagttccaaaccgggc
aatgttctcgagatcgtaaagtatctccagcaaacgcaacgaggtatcccgtggcagtct
tcaacagtagaaaccacgctgtcagagtcacagtcaccgctgtcgccgcctctacatacg
cgttttctgccttcagacacaccaattcaatcccgatcattctggctgctgcatggcctc
aagccacatgggagtctgtacatcgaccatggggcatatagcgctcttttgaacaaagcc
agtctcctaccagcaggtgtcgtcggtgtagatggccacttcggtcaacaggaagccgtg
cgactggttgttgttgagcgactctcgcccgactccctcaacggagacttcctccaccac
gggcaggaacccaaggaagttggccgtgcactggtcaattacggcagcgctgagattgca
cgcataaagggtcacagaagcacacacattcagtccttgctcggatatgctgatagcgaa
tacgttgctcttcgggagaatatatccttttttcggtcggatgattccgcacgccaatag

DBGET integrated database retrieval system