KEGG   Neosartorya fischeri: NFIA_083630Help
Entry
NFIA_083630       CDS       T01070                                 

Definition
NADPH cytochrome P450
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
nfi  Neosartorya fischeri
Brite
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     NFIA_083630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 710 aa AA seqDB search
MSLFSQWSSHPEILRDLFKVTSPASVADCAALTVVSIIACTYVSRGMLWDRPDPYLHLVY
ERPQLKNGGAAGSNANKQIRNIAQKMDETGKNVVVFWGSQSGTAEGFAHRLAREVSLRFG
QEAMTADLSDYDPDSVSMIPDSKLAIFILSTYGEGDPSDNTAEFWDCIHKTQNVSLSNLR
YAAFGLGNSNYKFYNRVVDVVVEALDRFGAKSLMPVGKANDAEGTTQEDFMSWKEDLFAT
FKQQLGFQEAEVKYMPTLSVQEDESLEPIDLHHGEPDIRRDSFRSAAQCSPVRAVDISSS
RELFASSDSHCLHIELDLSSQPEFTYKTGDHLAVWPGNPDAEVDILVNALGLPPSRHEVP
ISITSLDPATKVRVPTPTTPIALFRYYLEICAPVNRDTLLGLAQFSPTPAAKDFLLQLGQ
DKTAYASFLNHTHLTLGRLLQLACPDTPWTTLPLSYLIETLTPIQPRYYSISSSSVLAPR
KPSITVLVSCAPLPANPTQSIYGLTSNYLLALSASLASSAHPTGLTYPLAGPNASLTGGK
IHAHLRRSRFKLPLMSKCPLVMVAAGTGLAPFRAFIAERRQLSLIGKETGEMILFFGCRA
PTQDFIYKEELEEMQAALGDKLRVITAFSREVRSQKVYVQDRIAEHAAEVIRLIDEGANV
YICGRAGMAREVEKTVGEAMRAARRWSETELNEWSKAIKRKNKWQEDVWG
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttttctctcagtggagctctcaccccgagattcttcgggatctcttcaaagta
accagccctgcaagtgtcgccgactgtgctgctttgactgtcgtcagcatcatagcgtgt
acctatgtctcccgaggcatgctctgggaccggcccgatccttatctccatcttgtgtac
gaacggccgcaattgaagaatggcggcgcggctggctccaatgccaataagcagatccgc
aacattgctcagaaaatggacgaaacgggcaagaatgtcgtggtcttttggggctcccag
tccggcactgccgaaggttttgcgcaccggctggcccgcgaggtctcgctgcggttcggt
caggaggccatgacagctgacttgtccgattatgatccggactctgtcagtatgattcca
gactccaaactggcgatcttcattctctcgacctacggtgagggtgatcctagcgacaac
accgccgagttctgggattgtattcacaagacccagaacgtctccctgtccaacctccgc
tacgctgctttcggcttgggcaacagcaactacaagttctacaatcgcgtcgttgacgtc
gtcgtggaagctctggatcggtttggggctaagtcgttgatgcccgtcggcaaggcgaac
gatgctgaaggcacaacacaagaggatttcatgagttggaaggaggatctgtttgccacg
ttcaaacagcagctgggttttcaggaagccgaggtcaagtatatgccgacactgtccgtc
caggaagacgagtcgcttgagcccatcgaccttcaccatggagaaccggacatccgccgc
gactcgttcagatccgctgctcaatgctctcccgtacgggcagtcgacatcagcagctca
agggaactcttcgcttcctccgatagccactgtcttcacatcgaactagatctcagcagt
caacccgagttcacatacaaaaccggtgatcatctggccgtctggccgggcaatccagat
gccgaagtggacatcctcgtcaacgccctggggcttcctccgtctcgccacgaagtaccc
atcagcatcacatcgctcgacccagcaactaaagtgagagtccccactcccacgaccccc
attgccctcttccgctactatctggagatctgtgcccctgtcaaccgcgacactctcctc
ggactcgcccagttctcccccacgccagcagccaaggacttccttctccagctcgggcag
gacaagaccgcctacgccagcttcctcaaccacacccacctcacccttggtcggcttctg
cagctcgcctgccccgataccccgtggacaaccctcccactctcctatctcatcgagacg
ctcaccccaatccaaccccgctactactccatctcctccagcagtgtcctcgccccacgc
aaaccatccatcaccgtcctcgtctcctgcgccccgctcccagcgaacccaacccaatcc
atttacggcctaacatccaactacctcctcgccctctccgcatccctcgcctcgtccgcc
caccccaccggcctcacctacccgctcgccggtcccaacgccagcctgactggcggcaaa
atccacgcccacctccgccgcagccgcttcaaactcccgctcatgagtaaatgcccgctt
gtcatggtcgcagccggcacggggctggcccccttccgcgccttcatcgccgagcgccgc
cagctgagcctcatcggcaaagaaaccggcgagatgatcctttttttcgggtgccgggcc
ccgacgcaggatttcatctacaaggaggaactggaggagatgcaggcagctcttggcgat
aagctccgcgtcatcactgcgttctcgcgggaagtccgcagccagaaagtctacgttcag
gatcggatcgcggagcatgccgccgaggtgatccggctgatcgacgagggcgcgaacgtg
tacatctgcggccgggcggggatggcccgcgaggtggaaaagacagttggggaggcgatg
cgagcggccaggaggtggagcgagaccgaactaaacgagtggagtaaggcaatcaagagg
aagaataagtggcaggaggatgtatggggatag

DBGET integrated database retrieval system