KEGG   Aspergillus fischeri: NFIA_084230Help
Entry
NFIA_084230       CDS       T01070                                 

Definition
(RefSeq) 20S cyclosome subunit (BimA/Nuc2/Cdc27), putative
  KO
K03350  anaphase-promoting complex subunit 3
Organism
nfi  Aspergillus fischeri
Pathway
nfi04111  Cell cycle - yeast
nfi04113  Meiosis - yeast
nfi04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    NFIA_084230
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    NFIA_084230
   04113 Meiosis - yeast
    NFIA_084230
Protein phosphatases and associated proteins [BR:nfi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NFIA_084230
Ubiquitin system [BR:nfi04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     NFIA_084230
Chromosome and associated proteins [BR:nfi03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    NFIA_084230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPR_1 TPR_2 TPR_8 TPR_11 TPR_14 TPR_12 TPR_19 TPR_16 TPR_17 TPR_7 TPR_15 ANAPC3
Motif
Other DBs
NCBI-GeneID: 4586926
NCBI-ProteinID: XP_001260368
UniProt: A1DGG4
AA seq 755 aa AA seqDB search
MRCSSPVVYMLTSPERRKRHIYSLSVTFRTVKSKPHTITAGILDREAPTSAAPMSSRKHK
HSETRRQHLPDAAAVFCLLGKLWHAHKDINKAVECYVESLKLNPFMWDAFQGLCDTGVNV
RVSNIYKMNSELLAVLSSSPQDDAEPISDKSAQTNGPLQAQANVNPSSDPFASTTSRSDS
GTSHGSSALWEKLNGSTVSVASSGVPASIVHEGAETPSGQSSGSDEFRLANGKNGVDAPW
DPPLAPARKNRTIQAISGEYPMDPPPKMKPTGIRPRTRTRTDPEDQISTQTDREATIAPR
VGDRKRTVSGQVAHPPTSQPTEPGAPQRRSVRLFNQIKPTTSKLSASALGVKDAREVKKA
KATGTKGRTTTTTMGRVVSGSRKHGSEHHDADGKDGRSVPSAHTHAISKGTAHERSKEIE
ALTWLLELFSKLASGFFALCRYRCSESIQIFNSLSHGQRETPWVLAQIGRAYYEQAMYSE
AEKYFYRVKTMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMETDRLSPQAWCAIGNSF
SHQRDHDQALKCFKRATQLDPQFAYGFTLQGHEYVANEEYDKALDAYRHGISADSRHYNA
WYGLGTVYDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPKAALVQYGRACS
LAPHSVLARFRKARALMKLQELKLALSELKILKDMAPDEANVHYLLGKLYKMLHDKANAI
KHFTTALNLDPKAAQYIKDAMESLDDDEEDDEDMS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgttcctcgccggtcgtttacatgcttacgagccccgaacggcggaagcgtcat
atctactcgctctctgtcaccttcagaacggtcaagtcaaagccgcatacgattacagca
ggaattttggatcgagaggcacccacctcggctgctcctatgtcttcgcgcaagcataag
cacagtgagacgcgaagacaacacctgccggatgcagctgcagtattctgcctgctaggt
aaactatggcatgcgcataaggacatcaacaaagctgtggaatgctatgttgaatctctg
aagctgaatcccttcatgtgggatgcgttccaagggttgtgcgataccggcgtcaatgtc
cgcgtgtcgaacatctacaagatgaattctgaattgctggccgtattgtcttcatcgcca
caggacgacgctgagccaatatccgataagtctgcacaaacgaacgggccactgcaagcg
caggcgaatgtcaatccaagttccgatccttttgcctcgactacttctcgcagtgattca
ggtaccagccatgggagctctgccttgtgggaaaaactaaatggaagcacagtaagcgtg
gcgtcatcgggagtgccagcatcaatcgtgcatgaaggggccgaaacgccgagtggtcaa
agcagcggatctgatgagttccggttagccaacggaaagaacggcgtggatgctccttgg
gaccctcctttagctcctgcaaggaaaaacagaacgatccaggcaataagcggcgagtat
ccaatggaccccccgcccaagatgaaacccacggggatccgaccaaggacaagaaccagg
actgatccagaggaccaaatttcaacccagacagaccgggaggctacaattgcgcccagg
gtcggggaccgcaagcgaactgtttctggtcaggtagcgcacccccccacgtcacaaccc
acggaaccaggagcaccccagcggcggagtgtgcgactcttcaaccagatcaaacccacg
accagcaaattgtcggcatccgcattgggagtcaaggatgctagagaggtcaagaaggcg
aaggccacaggcacgaagggccgtactacaaccaccaccatgggacgagtagtgagtggc
agtcgaaaacatggcagcgaacatcatgatgcagatggtaaagacggtcggtcggtaccg
tctgcccacactcacgccatctccaaaggcactgcacatgaaagatcaaaagaaatcgag
gcgttgacctggttgctggagctattctcgaaacttgcttctggattctttgcgttgtgt
cgctaccgatgctcggagtcaatccagatcttcaattcgctctctcatggccaacgggaa
acgccgtgggttctcgctcagattggacgagcgtattatgagcaggctatgtattccgag
gcagaaaagtacttctaccgtgtgaagaccatggcaccctcgcgcttagaagacatggag
atctactcgactgtcctttggcatctgaagaacgatgttgagttagcctatttggcgcat
gagttgatggaaacagaccgcctgtcgccacaggcgtggtgcgccatcggtaattcgttc
tcccaccagcgggaccatgaccaggccttgaagtgctttaagcgggcaacacagctggat
ccccagtttgcctacgggtttactcttcaagggcacgagtatgttgccaacgaagaatac
gacaaggcgctggatgcataccgtcacggtatcagcgctgatagtcggcattacaatgct
tggtacggattgggcacggtctatgacaaaatgggcaaactggactttgccgaacaacac
ttccggaatgcggcaagcatcaacccgaccaacgcagttttgatctgctgtattggtctg
gtactggaaaaaatgaacaatcctaaagcggctctcgtgcaatatggtcgcgcttgttcc
ttggcacctcattccgtactcgcgcgattccgcaaggcccgcgcattgatgaagctccag
gagctcaagttagctctgtctgagttgaagattctcaaagacatggctccagatgaagcc
aacgtgcattatctgttgggtaagctctacaaaatgcttcacgacaaagccaatgccatt
aagcacttcacgactgctttgaacttggatcctaaggcagcacaatacatcaaggatgcc
atggaatctctcgacgatgacgaagaggatgatgaggacatgagttga

DBGET integrated database retrieval system