KEGG   Neosartorya fischeri: NFIA_084230Help
Entry
NFIA_084230       CDS       T01070                                 

Definition
20S cyclosome subunit (BimA/Nuc2/Cdc27), putative
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
nfi  Neosartorya fischeri
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:nfi04120]
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:nfi04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:nfi04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 755 aa AA seqDB search
MRCSSPVVYMLTSPERRKRHIYSLSVTFRTVKSKPHTITAGILDREAPTSAAPMSSRKHK
HSETRRQHLPDAAAVFCLLGKLWHAHKDINKAVECYVESLKLNPFMWDAFQGLCDTGVNV
RVSNIYKMNSELLAVLSSSPQDDAEPISDKSAQTNGPLQAQANVNPSSDPFASTTSRSDS
GTSHGSSALWEKLNGSTVSVASSGVPASIVHEGAETPSGQSSGSDEFRLANGKNGVDAPW
DPPLAPARKNRTIQAISGEYPMDPPPKMKPTGIRPRTRTRTDPEDQISTQTDREATIAPR
VGDRKRTVSGQVAHPPTSQPTEPGAPQRRSVRLFNQIKPTTSKLSASALGVKDAREVKKA
KATGTKGRTTTTTMGRVVSGSRKHGSEHHDADGKDGRSVPSAHTHAISKGTAHERSKEIE
ALTWLLELFSKLASGFFALCRYRCSESIQIFNSLSHGQRETPWVLAQIGRAYYEQAMYSE
AEKYFYRVKTMAPSRLEDMEIYSTVLWHLKNDVELAYLAHELMETDRLSPQAWCAIGNSF
SHQRDHDQALKCFKRATQLDPQFAYGFTLQGHEYVANEEYDKALDAYRHGISADSRHYNA
WYGLGTVYDKMGKLDFAEQHFRNAASINPTNAVLICCIGLVLEKMNNPKAALVQYGRACS
LAPHSVLARFRKARALMKLQELKLALSELKILKDMAPDEANVHYLLGKLYKMLHDKANAI
KHFTTALNLDPKAAQYIKDAMESLDDDEEDDEDMS
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgttcctcgccggtcgtttacatgcttacgagccccgaacggcggaagcgtcat
atctactcgctctctgtcaccttcagaacggtcaagtcaaagccgcatacgattacagca
ggaattttggatcgagaggcacccacctcggctgctcctatgtcttcgcgcaagcataag
cacagtgagacgcgaagacaacacctgccggatgcagctgcagtattctgcctgctaggt
aaactatggcatgcgcataaggacatcaacaaagctgtggaatgctatgttgaatctctg
aagctgaatcccttcatgtgggatgcgttccaagggttgtgcgataccggcgtcaatgtc
cgcgtgtcgaacatctacaagatgaattctgaattgctggccgtattgtcttcatcgcca
caggacgacgctgagccaatatccgataagtctgcacaaacgaacgggccactgcaagcg
caggcgaatgtcaatccaagttccgatccttttgcctcgactacttctcgcagtgattca
ggtaccagccatgggagctctgccttgtgggaaaaactaaatggaagcacagtaagcgtg
gcgtcatcgggagtgccagcatcaatcgtgcatgaaggggccgaaacgccgagtggtcaa
agcagcggatctgatgagttccggttagccaacggaaagaacggcgtggatgctccttgg
gaccctcctttagctcctgcaaggaaaaacagaacgatccaggcaataagcggcgagtat
ccaatggaccccccgcccaagatgaaacccacggggatccgaccaaggacaagaaccagg
actgatccagaggaccaaatttcaacccagacagaccgggaggctacaattgcgcccagg
gtcggggaccgcaagcgaactgtttctggtcaggtagcgcacccccccacgtcacaaccc
acggaaccaggagcaccccagcggcggagtgtgcgactcttcaaccagatcaaacccacg
accagcaaattgtcggcatccgcattgggagtcaaggatgctagagaggtcaagaaggcg
aaggccacaggcacgaagggccgtactacaaccaccaccatgggacgagtagtgagtggc
agtcgaaaacatggcagcgaacatcatgatgcagatggtaaagacggtcggtcggtaccg
tctgcccacactcacgccatctccaaaggcactgcacatgaaagatcaaaagaaatcgag
gcgttgacctggttgctggagctattctcgaaacttgcttctggattctttgcgttgtgt
cgctaccgatgctcggagtcaatccagatcttcaattcgctctctcatggccaacgggaa
acgccgtgggttctcgctcagattggacgagcgtattatgagcaggctatgtattccgag
gcagaaaagtacttctaccgtgtgaagaccatggcaccctcgcgcttagaagacatggag
atctactcgactgtcctttggcatctgaagaacgatgttgagttagcctatttggcgcat
gagttgatggaaacagaccgcctgtcgccacaggcgtggtgcgccatcggtaattcgttc
tcccaccagcgggaccatgaccaggccttgaagtgctttaagcgggcaacacagctggat
ccccagtttgcctacgggtttactcttcaagggcacgagtatgttgccaacgaagaatac
gacaaggcgctggatgcataccgtcacggtatcagcgctgatagtcggcattacaatgct
tggtacggattgggcacggtctatgacaaaatgggcaaactggactttgccgaacaacac
ttccggaatgcggcaagcatcaacccgaccaacgcagttttgatctgctgtattggtctg
gtactggaaaaaatgaacaatcctaaagcggctctcgtgcaatatggtcgcgcttgttcc
ttggcacctcattccgtactcgcgcgattccgcaaggcccgcgcattgatgaagctccag
gagctcaagttagctctgtctgagttgaagattctcaaagacatggctccagatgaagcc
aacgtgcattatctgttgggtaagctctacaaaatgcttcacgacaaagccaatgccatt
aagcacttcacgactgctttgaacttggatcctaaggcagcacaatacatcaaggatgcc
atggaatctctcgacgatgacgaagaggatgatgaggacatgagttga

DBGET integrated database retrieval system