KEGG   Neosartorya fischeri: NFIA_084280Help
Entry
NFIA_084280       CDS       T01070                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
nfi  Neosartorya fischeri
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    NFIA_084280
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NFIA_084280
   00640 Propanoate metabolism
    NFIA_084280
  Lipid metabolism
   00061 Fatty acid biosynthesis
    NFIA_084280
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    NFIA_084280
Enzymes [BR:nfi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NFIA_084280
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NFIA_084280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2292 aa AA seqDB search
MGVPNGSSSNGHVSSRAAKHNLPSHFIGGNHLDAAPPSSVKDFVANHEGHSVISSVLIAN
NGIAAVKEIRSVRKWAYETFGNERAIQFTVMATPEDLRANADYIRMADQYVEVPGGTNNN
NYANVELIVDVAERMDVHAVWAGWGHASENPRLPEALAASPKKIIFIGPPASAMRSLGDK
ISSTIVAQHAGVPCIPWSGTGVDDVTIDGNGIVTVPDEVYNRGCTFSPEEGLQKAKEIGF
PVMVKASEGGGGKGIRKVEREEDFISLYNAAANEIPGSPIFIMKLAGNARHLEVQLLADQ
YGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPATFQAMERAAVSLGKLVGYVSAGTVEYL
YSHADDKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIPLHRIRDIRLLYGVDPN
TSSEIDFDFSSEESFKTQRRPQPKGHTTACRITSEDPGEGFKPSSGTMHELNFRSSSNVW
GYFSVGTAGGIHSFSDSQFGHIFAYGENRSASRKHMVVALKELSIRGDFRTTVEYLIKLL
ETPAFEDNTITTGWLDQLISNKLTAERPDPIVAVLCGAVTKAHLASEGGVEEYRKGLEKG
QVPSKDVLKTVFPVDFIYEGQRYKFTATRAGLDSYHLFINGSKCSVGVRALADGGLLVLL
NGRSHNVYWKEEAAATRLSVDGKTCLLEQENDPTQLRSPSPGKLVKFTVENGEHVKAGQA
FAEVEVMKMYMPLIAQEDGIVQLIKQPGATLEAGDILGILALDDPSRVTHAQPFTGQLPD
LGPPQVVGNKPPQRFSLLHSILENILMGYDNQVIMNTTLKELVDVLRDPELPYGEWNAQS
SALHSRMPQKLDAQLQIIVEKAHARKAEFPAKQLQKTISRFIEENVNPADAEILKTTLLP
LQQVINKYMDGLKAHEFNVFAGLLEQYYKVESLFSGRNIRDEDAILKLREEHKDDIGSVV
QIVLSHSRIGAKNNLILAILAMYRPNQPGVGNVAKYFKPVLKKLTELESRPAAKVTLKAR
EVLIQCALPSLEERMSQMELILRSSVVESRYGETGWDHREPEFSVLKEVVDSKYTVFDVL
TRFFVHPDPWVTLAALEVYIRRAYRAYTLKGIQYYPDGEVPLVSWDFTLGKLGQPEFGSV
HSNQMSTPSTPTTESNPFRRLNSISDMSYLVNDNSNEPLRKGVIVPVQYLEDAEEQLPKA
LEALPRAGSKKKPGENGLIADLEGKRRPAPRIESDNELTGVCNVAVRDLEDLDDNQIVTQ
INNILAGLKEELLARRVRRVTFICGKNGSYPGYFTFRGPAYEEDESIRHSEPALAFQLEL
GRLSKFKIKPVFTENRNIHVYEAIGKGPENDKAVDKRYFVRAVVRPGRLRDDIPTAEYLI
SEADRLMNDILDALEIIGNNNSDLNHIFINFSPVFNLQPQDVEEALAGFLERFGRRLWRL
RVTGAEIRILCTDPATGMPYPLRVIITNTYGFIIQVELYIEKKSEKGEWLLHSIGGTNKL
GSMHLRPVSTPYPTKEWLQPKRYKAHLMGTQYVYDFPELFRQAFQNSWAKAVAKIPSLAS
KRPAVGECIEYSELVLDDTDNLIELSRGPGTNTHGMVGWIVTARTPEYPEGRRFIIVAND
ITFQIGSFGPQEDKFFYKCTELARKLGIPRIYLSANSGARIGMADELIPYFSVAWNDPQK
PEAGFKYLYLTPEVKQKFDASKKKEVITELIHDEGEERHKITTIIGAKDGLGVECLKGSG
LIAGATSRAYEDIFTITLVTCRSVGIGAYLVRLGQRAIQVEGQPIILTGAPAINKLLGRE
VYTSNLQLGGTQIMYKNGVSHMTATDDFEGVQKIVEWMSFVPDKKGAPIPIRPWSDDWDR
DVAYYPPSKQAYDVRWLIAGKEDEEGFLPGLFDAGSFEEALGGWARTVVVGRARLGGIPM
GVIAVETRSVENVTPADPANPDSMELISQEAGGVWYPNSAFKTAQALRDFNNGEQLPVMI
LANWRGFSGGQRDMYNEVLKYGSYIVDALVKYEQPIFVYIPPFGELRGGSWVVIDPTINP
DQMEMYADEEARGGVLEPEGIVNIKYRREKQLDTMARLDATYGELRRSLEDPSLSKEQLS
EIKAKMAAREEQLLPVYLQIALQFADLHDRAGRMVAKNTIRKALTWKNARRFFYWRVRRR
LSEELILKRMASVAPAAVSGEATGAIPATGPVDGQTPSTESPRAKHLRTLHSWTGFLDEE
LEHDDRKVAMWYEENRKAIQMKIEALKTDSVATEIAQLLISNKEGGLKGVQQVLSMLPVE
EREAVLKYLGSS
NT seq 6879 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtccccaacggaagctcgagcaacggccatgtcagctctcgtgcggccaaacac
aatcttccctcacatttcatcggtggaaatcacctggacgcagcacctccaagcagtgta
aaggatttcgttgccaaccatgagggtcactccgtcattagttcggtgctcattgccaac
aatggtatcgcagccgtcaaggagattcggtctgttcggaaatgggcttacgagacattc
ggcaacgaacgggccattcaattcacggtcatggccacaccggaggatttgcgggcaaac
gccgattacattcgtatggccgatcaatacgtcgaggtacccggaggcacaaataacaac
aactatgcgaacgtcgagctgatcgtcgatgtggccgagcgaatggatgtccacgccgtc
tgggctggttggggtcacgcatccgagaaccccagacttcccgaagctctggctgcttcc
cccaagaagatcatctttattggtcctccggcctccgcaatgcgttctctgggcgataag
atctcttcgacaatcgttgcacagcatgccggtgtgccttgcattccgtggtcaggaact
ggagttgacgatgtgacaatcgatgggaatggcattgtcaccgttcccgacgaggtctac
aaccggggttgcacgttctcccctgaagaaggtctgcagaaggccaaggagattggtttc
cccgtcatggtcaaggcctcggaaggtggtggtggtaagggtatccgtaaggtcgagcgg
gaggaggatttcatcagcctttacaatgccgccgcaaacgagatcccgggttcccctatc
ttcatcatgaagttggctggcaatgcccggcatctggaagtccagctgctggctgatcag
tacggaaacaacatctccctgttcggcagagattgctccgttcagcgccgtcaccagaag
attattgaggaggcccccgtcaccatcgcaaagcccgccacgttccaggctatggagcgt
gccgctgtcagcctcggaaagctggtcggttacgtctccgccggtaccgtcgagtacctg
tactcgcacgccgatgacaagttctacttcctcgagttgaaccctcgtcttcaggtcgag
caccccaccaccgagatggtctccggtgtcaacctgccagccgcccagctgcagatcgcc
atgggtatccccctgcaccgcattcgtgacatccgtctactttacggtgtcgaccccaac
acctcgtccgagattgacttcgacttctccagcgaagagagcttcaagacgcagcgccgc
cctcagcccaagggacacacgaccgcctgccgtatcacttctgaagatcccggcgaaggt
ttcaagccctccagcggtaccatgcatgaactgaacttccgcagttcgtccaacgtctgg
ggttacttctccgtcggtaccgccggtggtatccacagcttctccgacagtcagttcggt
cacatctttgcatatggtgagaaccgttccgcgtcgcggaaacacatggttgtcgctctg
aaggagttgagcatccgtggtgacttccgcacgacagtcgagtacctgatcaagctgctg
gagacccctgctttcgaggataacaccatcaccactggatggctggatcagctcatctcg
aacaagctgaccgcggagcgtccggatcccatcgtggctgttctgtgcggtgcggtgacc
aaggctcacctggccagcgaaggcggtgtcgaggagtatcgcaagggcctcgaaaagggt
caggtgccctccaaggatgtcctcaagaccgtcttccccgtggacttcatctacgagggc
cagcgttacaagttcaccgcaaccagagccggcttggacagctaccacctgttcatcaac
ggatccaagtgctcggtcggtgtccgtgctctggccgacggtggcctgcttgttctcctg
aacggtcgtagtcacaacgtctactggaaggaggaagcggctgcaactcgtctgagtgtc
gacggaaagacgtgcttgctggagcaggagaatgatcctacgcagctgcgctctccgtcc
cccggaaagcttgtcaagttcactgtcgaaaacggcgagcacgtcaaggctggtcaggcc
ttcgccgaagtcgaggtcatgaagatgtacatgcccttgattgcgcaggaagacggtatt
gtccagctcatcaaacagcctggtgccaccctcgaagccggtgacatccttggtattctc
gctctggatgacccgtctcgtgtcacgcatgctcagcctttcacgggacagctgcccgac
cttggccccccgcaggtggtcggtaacaagcctcctcagagattctccctccttcacagc
attctcgagaacatcctcatgggttatgacaaccaagttatcatgaacaccactctgaag
gagctggttgatgttctgcgggaccctgagcttccctacggtgaatggaacgctcagtct
tctgcccttcattctcgcatgccccagaagctggacgctcagcttcagatcatcgtcgag
aaggctcacgccagaaaggccgagttccccgccaagcagctgcagaagactatctcccgc
ttcatcgaggagaacgttaaccccgccgacgccgagatcctcaagaccactctcctccct
cttcagcaggtcatcaacaagtacatggatggcctgaaggcccacgagttcaatgtcttc
gctggattgctggagcagtactacaaggtcgagagcctcttctctggccgcaacatccgc
gacgaagatgccatcctgaagctcagggaagagcacaaggacgacattggcagcgtcgtt
cagattgttctgtcccacagccgtattggcgcgaagaacaacctgatcttggccatcctg
gccatgtaccgccccaaccagcctggtgttggcaatgtcgcaaagtacttcaagcccgtc
ctgaagaagctcactgaacttgagtcgcggcccgccgccaaggtcaccctcaaggcccgt
gaagtcctcatccagtgtgcgcttccctccctggaggagcgtatgtctcagatggaactc
atcctgcgctcatctgttgtcgaatcccgatacggagagaccggttgggaccaccgggag
cccgaattctccgtcctcaaggaagtggtggactccaagtacaccgtcttcgatgtcctt
acccgattcttcgttcacccggacccttgggtcaccctggctgctctcgaggtctacatt
cgccgcgcctacagggcctacacactgaagggtattcagtactaccccgatggagaagtt
cccctggtctcctgggactttacactaggcaagcttggacagccggagttcggttccgtt
cactccaaccagatgtctacgcccagcacacctaccacggagtccaaccccttcagaaga
ctcaactccattagtgatatgtcataccttgtcaacgacaacagcaatgagcccctcaga
aagggtgtcattgttccggttcagtacctggaagacgccgaggagcagctgcctaaggcc
ttggaggcactccctcgtgccgggtcgaagaagaagcccggcgagaacgggcttattgca
gacctggagggcaagcgtcgaccggcccctcgcattgagtccgacaatgaattgaccggt
gtctgcaacgtggccgtccgcgacctcgaagaccttgacgacaaccagatcgttactcag
atcaacaacattcttgccggcctcaaggaggagttgctcgctcgccgtgtccgccgcgtg
accttcatctgcggcaagaacggcagctaccctggctacttcaccttccgtggacctgcc
tacgaggaagatgagagcatccgtcacagcgaacctgcgctcgccttccagcttgaactc
ggacgtctgtccaagttcaagatcaagcccgtcttcaccgagaaccggaacatccacgtc
tacgaggccatcggcaagggccccgagaacgacaaggccgtcgacaagcgttacttcgtc
cgtgctgtggtgcgcccgggccgtctccgtgacgatattcccaccgcggagtacctcatc
tccgaggctgaccgtctcatgaatgacattctggatgctctggagatcatcggcaacaac
aattctgatcttaaccacatcttcatcaacttctcgccggtgttcaacctgcagccccag
gatgtggaagaggccttggccggtttccttgagcgcttcggtcgccgtctctggcgtctc
cgtgtcaccggtgccgagatccgtatcctgtgcaccgatcctgccactggcatgccttat
cctctgcgcgtgatcatcaccaacacctatggcttcatcatccaggttgagctgtacatt
gagaagaagtccgagaagggcgaatggctcctccacagcatcggtggtaccaacaagctc
ggctcgatgcacctgcgtcctgtctccacaccttacccgaccaaggagtggcttcagccc
aagcgttacaaggctcatctcatgggcacccagtacgtctacgatttccccgaattgttc
cgtcaggccttccagaacagctgggccaaggctgtggccaagatcccctccctggccagc
aagcggcccgcggttggcgagtgcattgagtacagcgagcttgttctcgatgataccgac
aacctgatcgaactctcgagaggccctggtaccaacacccacggtatggttggatggatc
gttaccgctcgcaccccggagtatcccgaaggcagacggttcatcatcgttgccaacgat
atcaccttccagatcggttccttcggtccccaggaagacaagttcttctacaagtgtacc
gagttggccaggaagcttggaatccctcgtatctacctctctgccaactccggtgctcgc
atcggtatggccgacgagctgatcccctacttctccgtggcctggaacgatccccagaag
cccgaggctggattcaagtacctttacctcactcccgaggtcaagcaaaaattcgatgcc
agcaagaagaaggaggtcattactgagctcattcacgatgagggcgaagagcgccacaag
attaccactatcattggtgccaaggatggcctgggtgttgaatgtctgaagggctctggt
ctcatcgccggagccacctcgcgcgcttacgaggacatcttcaccatcactctggtcacc
tgccgctccgttggtattggtgcctaccttgtccgtctgggccagagagccatccaagtg
gaaggccagccgatcattctgactggtgccccggccatcaacaagctgttgggtcgcgag
gtttacacgtctaacctgcagcttggtggtactcagatcatgtacaagaacggtgtctct
cacatgaccgccaccgatgactttgagggtgtccagaagattgtcgagtggatgtccttt
gttcccgacaagaagggtgcacccattcccatccggccctggtccgatgactgggaccgc
gatgtcgcctactaccctccttctaagcaggcttacgatgtccgctggctcatcgctggt
aaggaggatgaggaaggcttcctccctggtctgttcgatgctggatcctttgaggaggct
cttggtggatgggctcgtaccgttgttgttggtcgtgctcgcctcggtggcatccctatg
ggtgtaattgctgttgagactcgttccgttgagaacgttacccctgccgaccctgccaac
cctgactccatggagctgatcagccaggaagccggtggtgtgtggtaccccaactcggcc
ttcaagaccgctcaggccctccgtgacttcaacaatggcgagcagctgcccgtcatgatc
ctggccaactggagaggtttctccggtggtcagcgtgacatgtacaacgaggtcctcaag
tacggttcctacatcgtcgatgctctggtcaagtacgagcagcccatctttgtttatatc
ccacccttcggtgaacttcgtggtggttcatgggtcgtcatcgatcccacgatcaaccct
gaccagatggagatgtacgctgatgaggaggctcgcggtggtgtcctcgaacccgaaggt
atcgtcaacatcaagtaccgccgtgagaagcagctcgacactatggctcgtctcgacgcc
acctacggcgagctccgtcgctctctcgaggacccatccctcagcaaggagcagctctca
gagatcaaggccaagatggccgctcgcgaagagcagctcctgcctgtctacctgcagatc
gctctgcagttcgctgatctccacgaccgcgccggccgcatggtggccaagaacaccatc
cgcaaggccctgacctggaagaacgccagacgcttcttctactggcgtgtgcgccgccgt
ttgagcgaggagctcattctcaagcgcatggcctctgtcgccccggccgccgtctccggc
gaggccaccggcgccatccctgccaccggacccgtcgacggccagaccccatccaccgag
agccctcgcgccaagcacctgcgcaccctgcactcgtggaccggcttcctggacgaggaa
ctcgagcatgacgaccgcaaggtagccatgtggtacgaggagaacagaaaggccatccag
atgaagatcgaggccctcaagaccgactctgtcgccaccgagatcgcccagctgctcatc
agcaacaaggagggtggcctcaagggtgtgcagcaggttctcagcatgctgcctgtcgag
gagagggaggccgtgctcaagtacctgggatcatcttaa

DBGET integrated database retrieval system