KEGG   Aspergillus fischeri: NFIA_084470Help
Entry
NFIA_084470       CDS       T01070                                 

Definition
(RefSeq) dihydrofolate reductase, putative
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00670  One carbon pool by folate
nfi00790  Folate biosynthesis
nfi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NFIA_084470
   00670 One carbon pool by folate
    NFIA_084470
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NFIA_084470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1 Med3 DUF1682
Motif
Other DBs
NCBI-GeneID: 4586950
NCBI-ProteinID: XP_001260392
UniProt: A1DGI8
AA seq 249 aa AA seqDB search
MPPSQPLTLIVATTPIRTSENLPTRLGIGLHGTLPWPRIKADMAFFARATSRPPRPGTTN
AIIMGRKTYDSLPQNLRPLAKRINVVITRDSTGSVRERIMRELEAKRAKAAAAEQAQAQA
QKQEQAQAQTDALVSTGLEDALASLEGGYGAEGRLGNVFVIGGAEIYASALRMSETQPLR
IVMTNVERVDGTEFECDTFFPVDKELAAGGKWRMASEEEVSGWVGEEVSSKWREEGDVRI
QMVGYERIL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcccccctcacaacccctaaccctcatcgtggccacgaccccaatccgcacaagcgaa
aacctccccacccgcctcggcatcggcctgcacggcaccctcccctggccgcgcataaaa
gcagacatggcgttcttcgcgcgcgcgacatcgcggccccctcgccccggaaccacaaac
gcgatcatcatgggccgcaagacctacgactcgctgcctcagaacctccgcccgctcgcg
aagcgcatcaatgttgtgattacgagggatagtactggttctgtgcgggaacggataatg
agggagttggaggcgaagagggcgaaggctgctgctgctgagcaggctcaggcgcaagct
cagaaacaagagcaggcgcaggcgcagacagatgctctcgtgagtacagggctggaggac
gcgctggcgagtttggagggtggctacggggcggaggggagactggggaatgtatttgtg
attggtggggcggagatatatgcttctgcgttgcggatgagcgagacacaaccgctgcgg
attgtgatgacgaatgtggagagggtggatgggacggagtttgagtgtgatactttcttc
ccagtagataaggagcttgcggctggggggaagtggaggatggcgagcgaggaggaggtg
tccgggtgggtgggcgaggaagtctcgtcgaaatggagggaggagggcgatgtgcggatc
cagatggtgggttatgaacggatattgtag

DBGET integrated database retrieval system