KEGG   Neosartorya fischeri: NFIA_085670Help
Entry
NFIA_085670       CDS       T01070                                 

Definition
TOR pathway phosphatidylinositol 3-kinase TorA, putative
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
nfi  Neosartorya fischeri
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 2384 aa AA seqDB search
MAQAGPITDITQRLFSELKSKNEETRVRASFELYDNVLAISRDWPPEKFLEFYNAVSQRI
AQLVVTGSDAHERIGGLLALDRLIDFDGVDAAQKTTRFASYLRSALRSNDNAVLVYAARS
LGRLAKPGGALTAELVESEIQSALEWLQSERQESRRFAAVLVIRELAKGSPTLLYGFVPQ
IFDLIWVALRDPKVLIRETAAEAVSECFEIIAARDAQVRQLWFARIYEEALLGLRSSNVD
SVHGSLLVLKELLLKGAMFMNEHYRNACEIVLRLKDHRDHKIRAQVVQTIPILASYAPVD
FTETYLHRFMIYLQAQLKRDKERDAAFIAIGKIANAVGAAIAQYLDGIIIYIREGLALKA
RNRAAVNEAPMFECISMLSLAVEQALSKYMESLLDPIFACGLSESLTQALVDMAHYIPPI
KPTIQEKLLDMLSLILHGTPFRPLGCPESRLPPMPSFAKDFAPQELHSDAEIALALHTLG
SFDFSGHILNEFVRDVAINYVENDNPEIRKAAALTCCQLFVHDPIINQTSSHSIQVVSEV
IDKLLTVGIGDPDPEIRRTVLWSLDRKFDRHLARPENIRCLFLAVNDEVFAVREAAICII
GRLSSVNPAYVFPPLRKLLVNLLTGLGFASTARQKEESAQLISLFVSNATKLIRSYVDPM
VTTLLPKATDANPGVASTTLKAVGELASVGGAEMRNYLPQLMPIILDSLQDLSSHAKRES
ALRTLGQLASNSGYVIDPFLEYPHLLAVLINIIKTEQTGSLRKETIKLLGILGALDPYKY
QQISEIEPDVHHINEIQTVSDVALIMQGLTPSNEEYYPTVVIHTLMQNILRENSLAQYHS
AVIDAIVTIFKTLGLKCVPFLGQIIPGFISVIRGSPPSRLESYFNQMAILVNIVRQHIRA
FLPEIIEVIQEFWDSSYQVQATILSLVEAIAKSLEGEFKKYLAAMIPSMLDTLEKDNTPR
RQPSERILHAFLIFGASGEEYMHLIIPSMVRLFERAQNPQSIRKSAIDSLTRLSRQVNVS
DFASLMIHSLARVVAGNDRTLRQAAMDCICALIFQLGQDFCHYINLLNKVLTHHQINHVN
YQILVSKLQKGDPLPQDLNPDETTGTLADESSYSDIGQKKMVVNQQHLKNAWDASQKSTR
EDWQEWIRRFSVELLKESPSPALRACASLAGIYQPLARDLFNAAFVSCWTELYDQYQEEL
VRSIEKALTSPNIPPEILQILLNLAEFMEHDDKALPIDIRTLGKYAAKCHAFAKALHYKE
LEFEQDQNSGAVEALITINNQLQQSDAAIGILRKAQAYRDVELKETWFEKLQRWEEALAA
YKRREKIDPDSFGVTMGKMRCLHALGEWKVLSDLAQEKWNQASLEHRRAIAPLAAAAAWG
RGQWELMDSYLGVMKEQSPDRSFFGAILAIHRNQFDEATMYIEKARNGLDTELSALLGES
YNRAYNVVVRVQMLAELEEIITYKQNIGDPEKQESMRQTWNKRLLGCQQNVEVWQRMLKV
RALVTSPRENLDMWIKFANLCRKSNRMGLAERSLASLETVVTDNNGTRTIAPPEVTYARL
KFNWATGRQREALQMLKEFTANLTDDLNRFNALMVSQSDHNGINGVNGITEANHADMMGL
RERIGDVAKFRKLLSKSYLRQGEWQTTLQRGDWKPEHVREVLGAYSAATKYNRDSYKAWH
SWALANFEVVTTIASQTSRDGSIKPVVPGHIVTEHVIPAIGGFLRSIALSSTSSLQDTLR
LLTLWFTYGGDQEVNNVVTEGFNAVNIDTWLAVTPQLIARINQPNLKVRTAVHRLLAEVG
KAHPQALVYPLTVAMKSHITRRSQSASTIMDSMRQHSATLVEQADLVSHELIRVAVLWHE
LWHEGLEEASRLYFGDHDVEGMFATLAPLHDMLDKGAETLREVSFAQAFGRDLAEAKHYC
MLYRETEEIGDLNQAWDLYYTVFRKISRQLPQLSTLDLKYVSPRLKDCHDLALAVPGTYQ
SGRPIIRIISFDPILHVLQTKKRPRRMTLKGSNGSSYMYALKGHEDIRQDERVMQLFGLV
NTLLDNDGETFKRHLSVQRFPAIPLSQNSGLIGWVCNSDTLHALIKEYRESRRILLNIEH
RIMLQMAPDYDNLTLMQKVEVFGYAMDNTTGKDLYRVLWLKSKSSEAWLERRTNYTRSLG
VMSMVGYILGLGDRHPSNLLLERATGRVVHIDFGDCFEVAMHREKYPERVPFRLTRMLTF
AMEVSNIEGSYRITCEAVMRVIRDNKDSLMAVLEAFIHDPLINWRLNIRESPERPPFSTE
RRQSITSVMNLEHGVQPSNFSRHRRPSILDGGILDVQEGIPPEAREAQNARAVQVLARVK
EKLTGRDFKPTEELNVSDQVDKLLAQATSVENICQHWIGWCSFW
NT seq 7155 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaagcaggtcctattacggacatcactcagcgactcttcagtgagttgaagtcc
aagaatgaggagacgcgggtaagagcttcatttgagctctacgataacgtcctggctatc
tcgagagattggcctccggagaagttcctcgaattctacaacgctgtcagtcaacgcatc
gcgcagctcgtggtcaccggcagtgacgcacatgaacgcatcggcggccttttggctctc
gatcgcttgattgatttcgatggtgtcgatgcggctcagaaaaccactcgattcgctagt
tatctgcgcagcgccttgcgcagcaacgacaatgctgtgttggtctatgcagctcgatct
ttgggacgtttggcgaagccgggcggcgctcttactgcagaattggtcgaaagcgagatt
cagtcagcattagaatggcttcagtctgagcgacaggaaagcaggcgcttcgctgctgta
cttgtcataagagagcttgccaaaggctcaccaactcttctttacggcttcgttccacag
atcttcgacctcatctgggtcgctctgcgggaccccaaggttcttatccgagaaacagcc
gcggaagcggtctctgagtgtttcgagatcatagccgccagagacgctcaagtccgacaa
ttgtggtttgcaagaatatacgaggaagcacttctgggccttaggtcaagcaacgtggac
tcggtacatggatcgctcctagtactcaaggagcttctcctcaaaggagcaatgttcatg
aacgagcattatcggaatgcatgtgagattgttctccgtctaaaggatcaccgtgaccat
aagatccgggcccaagttgtccagacgattcctatactcgcctcctacgcccctgtcgac
tttacagaaacatacctacataggttcatgatttacctgcaggcgcaactgaagagagac
aaggaacgagacgcagcattcatagcgattggaaaaatcgccaatgcggtcggtgctgcc
attgcacagtatcttgatggaatcattatctacatacgcgaaggattggctctgaaagct
cgaaatcgagctgctgtaaatgaagcaccaatgtttgagtgcatcagcatgctatctttg
gctgttgagcaggcgctcagtaaatacatggaatctttgcttgaccctatatttgcatgc
gggttgagcgaatcactgacgcaagcacttgtcgacatggctcactatatcccgcctatc
aaacctaccattcaggaaaagctcttggatatgcttagcctgatccttcatgggacgccc
ttccgtcctctcggttgcccagagagcaggctacctcccatgccgtcattcgcaaaggac
ttcgctccacaagagttgcactctgatgcagaaattgctctggcacttcataccctgggg
agttttgatttctccggtcacattctcaatgaatttgtgcgcgatgtggccattaattac
gttgagaacgacaaccctgagattcggaaggctgcagcgctcacctgctgccagcttttt
gtccatgatccgatcatcaatcagacaagcagtcattccatacaggttgtcagtgaggtt
attgataaattattgactgtcgggatcggtgacccagacccagagatccgacgtaccgta
ctatggtcactggaccgcaaattcgatcgtcatctcgcaagacctgaaaacatccgctgc
ctgttcttggccgtaaatgacgaagtatttgccgttcgggaagctgcaatttgcatcatt
ggccgcctttcgagcgtcaacccagcctatgtgttcccgccactacgaaaattgctagtg
aatcttctgacagggcttgggttcgcgagcacagcccgacagaaggaggagagtgctcaa
ctcatcagcctattcgtatcaaatgcgaccaaacttattagatcgtatgtcgatcctatg
gtgacaaccttacttccgaaggcgacggatgccaacccaggcgtcgcctcgaccacattg
aaagctgtcggggaacttgcgagtgtcgggggcgcggaaatgagaaattacctcccgcag
ctcatgccaattatcctggactcgttgcaggatctctcttcgcatgctaagcgagagtcg
gctttacggacactgggccaattagccagcaactctggctatgtcattgatccgtttctc
gaatatccacatttacttgccgtgctcattaatatcatcaagactgagcaaactgggtca
ctgcgcaaagagactatcaagttactgggaattcttggtgctcttgatccgtacaagtac
caacagatcagtgaaatcgaacccgatgtccaccacatcaacgaaattcagacagtttct
gatgttgccctcataatgcagggcctcacgccttccaacgaggagtattatccaaccgtg
gtcatccataccttgatgcagaatatcttgcgtgagaattctctcgctcagtaccactct
gcggtcattgatgcgattgttacaatcttcaaaactctgggtttgaagtgcgtgccgttt
ttagggcagatcattcccggcttcatatcggtcatccgaggttcgccgcctagccgccta
gaatcctacttcaatcagatggctatcttggtgaatattgttcgacagcatattcgagcc
ttccttccggagattatcgaggtcatccaggaattttgggattcatcgtaccaagtgcaa
gcgactatcttgtcacttgtcgaagcgatagccaagtctctggagggtgagttcaaaaag
tacctggcagccatgattccttcaatgttggacactcttgagaaggacaacacgcctcgc
cgccagccttcagaaaggattctccacgcgttcctcatctttggcgccagtggggaagaa
tacatgcatctgatcatcccatctatggtacggctctttgagagagcccagaatcctcaa
agtatcaggaaatcggccatcgatagcctcacaaggctgtcgcgacaagtaaatgtttct
gactttgcatctctgatgattcactcattggctcgggttgttgcaggcaacgaccggacc
ttaagacaagcagccatggactgtatctgtgctcttatcttccagctcggccaggatttc
tgccactacataaatctcctgaacaaggtcttgacgcatcaccagatcaatcatgtcaat
taccagattctagtttccaagctccaaaagggcgatccgctgccacaggacttgaatccc
gatgagactacgggtacactggcggatgaatctagctattctgacattggccagaagaag
atggttgtgaatcagcaacatctgaagaacgcttgggatgcctctcaaaagtcaacgcgt
gaagactggcaggaatggatacgaagattcagcgtggagcttttgaaagaatcaccttca
ccagcactccgggcatgcgccagtttggccggtatctaccagccattagcaagggacctc
tttaacgcagcatttgtatcctgctggacggagctgtacgatcagtatcaagaagagctc
gtacgctcaattgagaaggctcttacttcacccaatatccctcctgagatactccaaata
cttctcaatcttgctgagtttatggagcatgatgataaagctcttcccattgatattcgt
acacttggcaagtacgccgcaaagtgtcatgcatttgccaaggcactccattataaagag
ctggaatttgagcaagaccagaactccggtgccgtggaggctctgatcaccattaacaac
cagcttcagcagtctgacgccgctattggtatccttcgcaaagcccaagcctacagggat
gtagagctgaaggagacatggtttgagaaacttcagcgatgggaagaggcacttgctgct
tacaaacgccgtgagaaaattgatccagactcgtttggtgtcactatgggcaaaatgcgg
tgtctgcatgcgcttggcgagtggaaggtattatctgacctcgcccaagagaagtggaac
caggcttcgctagaacatcgcagagccattgctcccctagcagcagcagcagcatgggga
cgaggtcagtgggagctgatggattcctacttgggtgtgatgaaagagcagtccccggat
aggtctttcttcggtgcaattctcgcgatccatcgaaatcaatttgatgaggcgacaatg
tacattgagaaagctcggaacggcctcgacacggaactatcagctttacttggagagtca
tataaccgtgcctacaacgttgtcgtccgtgttcagatgcttgctgaattggaggagatc
atcacctacaaacagaacattggggaccctgagaaacaggagtcaatgcgtcagacatgg
aacaagaggttgctcggctgccaacagaacgttgaagtatggcaacgcatgctcaaggtc
agggcgctcgtcacttcaccccgcgaaaaccttgatatgtggatcaaatttgccaacctc
tgccgtaaatccaatcgcatgggacttgccgagcggtctcttgcatctttggagactgtt
gtcactgacaacaatggtacaagaactatcgctcctcccgaagtgacctacgctcgcttg
aaatttaattgggctactggtcgccagcgtgaagctcttcagatgctgaaagagttcact
gcaaatctgacggatgatttgaatcgctttaacgcgctcatggtatcacagtccgatcat
aacggaatcaatggtgtcaacggaattacagaggcaaatcatgcggatatgatgggtctc
cgtgaacgtattggcgatgtagccaagttccgcaagctgctttctaagagttatcttagg
cagggagagtggcagacaactttgcaacgaggcgactggaagcccgaacacgttcgcgag
gttcttggcgcatattctgcggccacgaaatacaaccgcgactcgtacaaagcctggcat
tcctgggctttggccaacttcgaagtcgtgacaacgattgccagtcagacaagcagggac
gggagtatcaagcccgtagtccctggccatattgtgacagagcatgttatacctgccatt
ggaggcttcctcagatcaatcgctttgtcgtccacctcgtctctccaggataccctgaga
ctgctgaccctttggttcacttacggcggtgaccaagaagttaataatgttgtcacagaa
ggcttcaacgcagtgaacattgacacctggcttgcggtaactccacaactcatcgctcgt
atcaaccaaccaaacctcaaggtccgaaccgctgttcatcgcctcctggccgaagtgggc
aaggcccatccgcaggcgctggtgtacccattaaccgttgcgatgaaatcgcacattacc
cgccgttcgcaatccgccagcaccattatggatagtatgcggcagcacagtgctacttta
gtcgagcaggccgatctcgtcagtcatgaattgattcgagtcgcggttctgtggcacgaa
ctctggcatgaaggcttggaggaagcctctcgactctacttcggtgaccatgatgtggag
ggcatgtttgcaactctggcgccactgcatgacatgcttgacaagggtgcggaaacgctg
cgtgaggtttctttcgcgcaggcgtttggacgggatcttgcagaggcgaagcactattgt
atgctgtatcgtgagacggaagaaattggcgatctcaaccaagcttgggatctctactat
actgtattccgcaagatcagccggcagctcccacagttgtcgactcttgacctcaaatac
gtctctcccaggctcaaggactgtcatgaccttgctcttgctgttcccggaacctaccag
agtggcagaccaatcatccggatcatcagctttgatcctatattgcacgtgcttcaaact
aagaagcgacctcgacgcatgactctgaagggaagcaacggaagctcttacatgtatgcc
cttaagggacatgaggacattcggcaagacgagagagtcatgcagttgttcggacttgtg
aacactttgcttgataacgatggcgaaaccttcaagcgacatctttccgtccagcgtttc
cctgcaatcccattgtctcagaactctggtctgataggatgggtctgcaacagcgataca
ttacatgcgctgatcaaagagtaccgtgaaagtcgccgcatcctactcaatatcgaacat
cgtattatgctgcagatggcgccagattatgacaatctcactctgatgcaaaaggtcgag
gtcttcggatacgccatggacaacactactggaaaggatctgtatcgtgttctgtggctc
aaaagtaagagttccgaggcctggcttgagcgtcggacgaattatacaagatctctggga
gtcatgtcgatggtgggctatattcttggtctgggtgaccgtcatccgtccaaccttctg
ctggagcgcgccacaggaagagtggttcatatcgatttcggtgactgcttcgaggtggca
atgcaccgtgagaagtatccagagagggtgcccttccggttaactcgcatgttgactttc
gccatggaagtcagcaatattgagggaagctaccgtatcacttgcgaggctgttatgcgc
gtgatcagagacaacaaggattcccttatggccgttctggaagcattcattcacgatccc
ttgatcaactggcgtttgaacattcgcgagtcaccagaacggccgccgttcagcactgag
cgccgacagtcgattacgtccgtcatgaaccttgaacatggcgttcagcccagcaatttc
tcccgtcaccgtcgcccatctattctcgacggtggtatcctcgatgtccaggagggcatt
ccgcccgaagcccgtgaggcacagaatgcacgagcagtgcaggtgcttgctcgggtcaag
gagaagctcacaggtagagacttcaagcccactgaagagctcaatgtgagtgatcaagtg
gacaaacttctcgcgcaggcaacgagcgtggagaacatatgtcagcattggattggatgg
tgtagtttctggtga

DBGET integrated database retrieval system