KEGG   Neosartorya fischeri: NFIA_085890Help
Entry
NFIA_085890       CDS       T01070                                 

Definition
urate oxydase UaZ
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nfi  Neosartorya fischeri
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NFIA_085890
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    NFIA_085890
Enzymes [BR:nfi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     NFIA_085890
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSAPVTAARYGKDNVRVYKVHRDEKSGVQTVVEMTVCVLLEGEIETSYTKADNSVIVATD
SIKNTIYILAKQHPVTPPELFGSILGTHFIQKYKHIHAAHAHIITHRWTRMNIDGKPHPH
SFVRDSEETRNVQVDVTKGAGIDIKSSISGLTVLKSTGSQFHGFLRDEYTTLKETWDRIL
STDVDASWQWKRFRDLGEVRANIPKFDAAWSAAREITLKTFAQDNSASVQATMYKMSEQI
LAVEPFIETVEYSLPNKHYFEVDLSWHKGLKNLGKDAEVYAPQTNPNGLIKCTVGRSSKS
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccctgtcactgctgctcgctacggaaaggacaatgtccgtgtctacaaggtc
catcgggacgagaagtccggtgtgcagacggtggtggagatgaccgtctgtgtgctgttg
gagggagagattgagacttcctacaccaaggccgacaacagcgtcattgtcgctaccgac
tcgatcaagaacaccatctacatcctcgccaagcagcaccccgtcactcccccagagctc
ttcggctccattctgggcacccacttcattcagaaatacaagcacatccacgccgcacac
gctcacatcatcacccaccgctggacgcgcatgaacattgacggcaagccccacccccac
tccttcgtccgcgacagcgaggaaacccgcaacgtccaggtggacgtgaccaagggcgcc
ggcatcgacatcaagtcctcgatctctggccttaccgtgctcaagagcaccggctcgcag
ttccacggcttcctgcgcgacgagtacaccaccctcaaggagacctgggatcgtatcctg
agtaccgatgtcgatgcctcgtggcagtggaagcgctttcgcgaccttggcgaggtccgc
gcgaacattcccaagttcgatgccgcctggtctgcggcccgggagatcaccctcaagact
tttgcccaggacaacagtgctagtgtgcaagctactatgtacaagatgtccgagcaaatt
ctggcggtcgagcccttcattgagactgtcgagtactctctgcctaacaagcactacttt
gaagttgacctcagctggcacaagggcctcaagaacctcggcaaggatgcggaggtgtac
gcgcctcagacaaatcccaatggattgatcaagtgcactgtgggccgctcatccaaatct
aagctgtga

DBGET integrated database retrieval system