KEGG   Neosartorya fischeri: NFIA_085950Help
Entry
NFIA_085950       CDS       T01070                                 

Definition
disulfide isomerase, putative
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
nfi  Neosartorya fischeri
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nfi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NFIA_085950
Enzymes [BR:nfi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NFIA_085950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 737 aa AA seqDB search
MRSSLLAWSLLSLLSIPTFAIPSGDITNDLNLANNRLVKRAEPVEKTESGPASTTFNGVE
VPPLKELTPENFEELTKNGYWFVKHYSPSCPHCKAIAPTWQTLYEYYYTSKPLSSSSEPS
DTQSLNSFQNFYNFHFASMNCLAFSDFCKRLDVNWFPTFSLYHNGKLVEQFEGAKTMEGL
SEFVEGKLESIRPGSRPPKGVKLPKPGDKQVDTEAAPDVPAAKDKDRVAGVKAGEKHNEQ
VAQLASTEAPVKSATPKVNSKPSAPANPQGISVPLTAESFQKLVTTTRDPWFVKFYAPWC
HHCQALAPVWQGMAREMQHVLNVGEVNCDAEPRLCKDARVNAYPTMYFFRGGERVEYTGL
RGLGDLVNYAKKAVDIGSGVQDVDAAQFKQLEEKEEVIFLYFYDHATTSEDFEALERLTL
SLVGHARLVKTSSAALAERFKITTWPRLLVSRDGRPSYYNALAPKDMRDVRQILNWMRSV
WLPIVPELTVSNAREIMDGKYVILGILSRRRSDDFILAKRELKSAALEWMDKQTQLFRLE
RQELRDAKQLRIEEAEDRNDQRALRAAKNMRISIREDDKKQVGFAWVDGEFWERWLRTTF
GIDIENGERVIINDQDNRRYWDATSSGAPIMASRTSILETIPLVIADSSKLKPKSTVGTF
EYIFFVTRSFISSHPIIFVALLTMSIVAVTYLARARLAKRGLSRGGILGAVQSNSAGFFR
LDGKEGLLNGGGTGKVD
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcctctttgctggcgtggtcgctcctttcgcttctctctatcccaacttttgcc
attccttccggcgatatcacaaatgatctcaatcttgcgaacaatcgcctcgtcaaaaga
gcggaaccggttgaaaagactgagtcggggccggcgtcgacaacattcaatggcgtcgaa
gtaccgcccctgaaagagttgacaccagagaacttcgaggagcttaccaaaaacggttac
tggtttgtgaagcactattctccgtcatgtccccattgcaaggcgatcgctcccacatgg
cagactctatacgaatactactatacatcgaaaccgttatcctcctcttccgagccctcc
gatactcagtcccttaactcctttcaaaatttttacaactttcacttcgcttcgatgaac
tgtcttgcattttcggatttctgcaagagactggatgtcaattggtttccgacattttcc
ctttaccataatggcaagctggttgaacagtttgagggtgctaagactatggaaggtcta
agtgagttcgttgaaggcaagctagaatcaatccgacctgggtctcgtcctccgaaaggc
gtaaagcttcccaagccgggcgacaaacaggtagacacggaagctgcgccggacgttcca
gccgccaaggacaaggaccgtgtggcgggagtcaaggctggtgagaagcataatgaacaa
gtcgctcagctcgccagcacagaggctccggtgaaatctgctacccctaaggtgaactcg
aaaccatccgcgcctgcgaatcctcaaggtatctccgttcctcttacagcagagagcttc
caaaagctggtcacgactaccagagatccctggttcgtcaagttctatgctccgtggtgc
catcactgccaagcgctggcgcctgtttggcagggaatggcccgggagatgcagcatgtc
ctcaacgttggagaggtgaattgcgacgcagagcccaggctttgcaaggacgctcgggtg
aacgcctacccgacaatgtacttcttccgtggtggcgaacgcgttgaatacaccggtcta
cgcggtcttggcgatttggtcaactacgcgaagaaggctgtggacattggatctggtgtt
caggatgtcgacgcagctcaattcaaacagctggaagaaaaggaagaagtgatctttctg
tacttttacgaccacgcaacgacctctgaagattttgaggccttggaacgtttgactctc
agcctggtgggtcacgccagattggtcaagacaagcagtgcggctcttgccgagcggttc
aagatcacaacctggcctcgtctcttagtatcccgagatggacgtcccagttactacaat
gctctggctcccaaggatatgcgggacgtccgccagattctgaactggatgcgctccgtt
tggctgcctattgtccctgaactcacagtctctaacgcccgtgagatcatggacgggaaa
tatgttattctggggattctgagccggcgccgctcggatgatttcatccttgccaagaga
gaattaaagagtgccgctctggagtggatggacaagcaaacccagttgttccgattggag
agacaagaacttagggatgctaagcagctacgtattgaggaggcagaagaccgcaatgac
caacgtgccttgcgggctgctaagaacatgcgcatttctatccgggaagatgacaagaag
caagttggatttgcctgggttgatggcgagttctgggaacggtggctgaggaccactttt
ggtatcgatatcgagaacggagaacgggtcatcattaacgaccaggataaccgacgctat
tgggacgccacttctagtggagctccgatcatggcctcgcgaacctccatccttgaaacg
attccgctggtcattgccgactcgtcgaagttgaagcccaagtccacagtcggaacattc
gaatacatattcttcgtcactcggtcctttatttccagccatcccatcattttcgtcgca
ttgttgaccatgagcattgttgccgtcacttacttggctcgagcaaggctggcaaagcgc
ggtctcagtcgtggtggcatcctcggtgcggttcagagcaacagtgccggctttttccgt
ctcgatgggaaggaaggtctactgaatgggggcggcaccggaaaggtcgattag

DBGET integrated database retrieval system